Recombinant Chicken Anti-apoptotic protein NR13 (NR13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NR13; Anti-apoptotic protein NR13; Apoptosis regulator Nr-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
NR13
Target Protein Sequence
MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAE PREAAALLRKVAAQLEAEGGLNWGRLLALVVFTGTLAAALAESGCEEGPSRLAAALAAYL AEEQGEWLEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIMAAAGFGIAGLAFLLVVR
Uniprot No.

Target Background

Function

Exhibits anti-apoptotic properties and counteracts the pro-apoptotic effects of BAX.

Database Links

KEGG: gga:395193

UniGene: Gga.22069

Protein Families
Bcl-2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed preferentially in heart, skeletal muscle, retina, optical tectum and bursa of Fabricius.

Q&A

What is NR13 and what is its primary function in avian systems?

NR13 is a Bcl-2 family member that functions as an anti-apoptotic protein primarily expressed in developing avian B cells. It contains all four Bcl-2 homology (BH) domains that are characteristic of this protein family - BH1, BH2, BH3, and BH4 . NR13's primary function is inhibiting apoptosis during avian development, particularly in the bursa of Fabricius, a unique primary lymphoid organ found only in birds that serves as the site of B cell maturation.

Structurally, NR13 contains a conserved NWGR motif in the BH1 domain and a GGW motif in the BH2 domain, both of which are characteristic of pro-survival Bcl-2 family proteins . When expressed in cells, NR13 localizes primarily to mitochondrial and endoplasmic reticulum membranes, where it acts to prevent cytochrome c release and subsequent caspase activation .

How does NR13 expression change during avian development?

NR13 displays a distinctive developmental expression pattern that correlates inversely with apoptosis rates in the avian bursa. Northern blot analysis reveals that NR13 RNA is present at high levels in bursal follicles during embryonic development (days 15-21 of embryogenesis) but decreases significantly after hatching, becoming undetectable by 28 days post-hatching .

This pattern distinguishes NR13 from other Bcl-2 family members expressed in the bursa, as shown in the table below:

Bcl-2 Family MemberEmbryonic BursaPost-hatching Bursa (Day 28)Correlation with Apoptosis
NR13High levelsUndetectableInverse correlation
Mcl1High levelsDecreased but presentPartial correlation
A1Low levelsLow levelsNo clear correlation
Bcl-xLLow levelsLow levelsNo clear correlation

To study this pattern, researchers typically employ Northern blotting, RT-PCR, or immunoblotting techniques using embryonic and post-hatching bursal tissue samples at various developmental timepoints .

How does NR13 inhibit apoptosis at the molecular level?

NR13 inhibits apoptosis through multiple molecular mechanisms, primarily through protein-protein interactions with pro-apoptotic factors. Experimental evidence indicates that:

  • NR13 directly interacts with the pro-apoptotic protein Bax through its BH domains. Coimmunoprecipitation studies have demonstrated that Bax physically associates with NR13 in DT40 cells and primary bursal lymphocytes .

  • NR13 exhibits high-affinity binding to cytochrome c, which may prevent its release from mitochondria or sequester released cytochrome c, thereby preventing caspase activation. This interaction can be disrupted by BH3 domain peptides from Bax .

  • The BH4 domain of NR13 is critical for its anti-apoptotic function. Deletion mutant studies show that removal of the BH4 domain converts NR13 from an anti-apoptotic protein into a death agonist that enhances apoptosis under serum deprivation conditions .

To investigate these mechanisms, researchers typically employ binding assays with purified proteins, fluorescence spectroscopy monitoring tryptophan fluorescence changes upon interaction, and functional assays in cell-free systems such as Xenopus egg extracts to measure caspase-3 activation .

What cellular and animal models are available for studying NR13 function?

Several experimental systems have been developed to study NR13 function:

  • DT40 Cell Line: This chicken bursal lymphoma cell line expresses c-Myc constitutively due to retroviral insertion. DT40 has low endogenous NR13 expression and undergoes apoptosis upon serum withdrawal, making it ideal for overexpression studies. Researchers use retroviral vectors like LNRSN (neomycin resistance) or LNRCG (GFP expression) to introduce wild-type or mutant NR13 into these cells .

  • Primary Embryonic Bursal Cells: These can be isolated from day 15-21 chicken embryos and used for ex vivo studies. Upon dispersion, these cells rapidly undergo apoptosis, providing a model to study NR13's protective effects .

  • Bursal Transplantation Model: This in vivo model involves transplanting embryonic bursal cells (day 15) into cyclophosphamide-treated recipient embryos (day 18). The cells can be modified ex vivo through cocultivation with retroviral vectors expressing NR13 before transplantation. Secondary transplantation experiments using cells from primary recipients can assess stem cell persistence .

  • Cell-free Systems: Xenopus egg extracts provide a biochemical system to study NR13's effects on the apoptotic machinery without cellular complexity. Purified recombinant NR13 can inhibit caspase-3 activation in this system .

For molecular studies, E. coli expression systems can produce biologically active recombinant NR13 protein that maintains correct folding as verified by circular dichroism and fluorescence spectroscopy .

What factors regulate NR13 expression in avian cells?

NR13 expression is regulated by several factors that influence its transcription and protein stability:

  • Oncogene v-rel: This avian retroviral oncogene, a member of the NF-κB family of transcription factors, induces NR13 expression. Studies in DT40 cells with temperature-sensitive v-rel showed that NR13 RNA levels increased when v-rel was activated. This induction of NR13 may contribute to v-rel's ability to inhibit apoptosis in bursal cells .

  • Phorbol Myristate Acetate (PMA): This protein kinase C activator induces NR13 expression in both DT40 cells and primary bursal cells. Northern blot analysis shows NR13 RNA increases within 1 hour of PMA treatment and continues to increase for at least 6 hours. This correlates with PMA's known ability to transiently inhibit bursal cell apoptosis .

  • Cell-cell Interactions: When embryonic bursal cells are dispersed (disrupting cellular contacts), NR13 protein levels decrease rapidly while Bax levels increase. Western blot analysis shows that Nr13 levels decrease by 2 hours after dispersion, while Bax increases within 30 minutes .

To study these regulatory mechanisms, researchers employ Northern blotting to measure RNA levels, Western blotting for protein expression, and reporter gene assays to identify transcriptional regulatory elements in the NR13 promoter.

What is known about viral homologs of NR13 and their functions?

Herpesvirus of turkeys (HVT), a nonpathogenic alphaherpesvirus used as a vaccine against Marek's disease, encodes a viral homolog of NR13 called vNr-13. This viral protein is encoded by identical copies of the genes HVT079 and HVT096 . Research on vNr-13 has revealed:

  • Structural Conservation: vNr-13 maintains the exon/intron structure and four BH domains characteristic of cellular Nr-13, strongly supporting its classification as a true Nr-13 ortholog. It contains the conserved NWGR motif in the BH1 domain and GGW motif in the BH2 domain typical of pro-survival Bcl-2 family proteins .

  • Subcellular Localization: In transfected cells, vNr-13 shows primarily diffuse cytoplasmic distribution with faint nuclear staining. It localizes to mitochondria and endoplasmic reticulum (ER) and disrupts mitochondrial network morphology .

  • Function in Viral Replication: Deletion mutant studies (HVT-ΔvNr-13) show that vNr-13 contributes to viral replication. The mutant virus showed 1.3- to 1.7-fold lower growth of cell-associated virus and 3- to 6.2-fold lower growth of cell-free virus at early time points post-infection .

  • Anti-apoptotic Activity: Real-time apoptosis monitoring using IncuCyte S3 with caspase 3/7 reagents demonstrated that vNr-13 unequivocally inhibits apoptosis in infected cells. This appears particularly important under serum-free conditions in later stages of viral replication .

These findings suggest that HVT vNr-13 may have been acquired from the host genome and maintained to support virus replication through apoptosis inhibition, particularly during infection of embryonic tissues when host Nr-13 is also highly expressed .

What advanced techniques are used to study NR13 protein interactions and function?

Several sophisticated techniques are employed to investigate NR13's structure, interactions, and functions:

  • CRISPR/Cas9 Gene Editing: This technique has been applied to create deletion mutants (as demonstrated with vNr-13 in HVT), allowing precise assessment of gene function. For example, researchers used nine combinations of gRNAs to target and delete exon 1 of vNr-13 in the viral genome .

  • Real-time Apoptosis Monitoring: The IncuCyte S3 live-cell analysis system with caspase 3/7 reagents allows continuous monitoring of apoptosis in living cells. This provides detailed kinetic data on how NR13 affects the timing and extent of apoptosis under various conditions .

  • Mitochondrial Network Analysis: Confocal microscopy combined with mitochondrial-specific dyes enables visualization of how NR13 affects mitochondrial morphology and network integrity—critical aspects of its anti-apoptotic function .

  • Protein-Protein Interaction Studies: Advanced methods include:

    • Fluorescence spectroscopy to monitor intrinsic tryptophan fluorescence changes upon binding of peptides or proteins

    • Circular dichroism to verify correct protein folding

    • In vitro reconstitution of purified components to define direct interactions

  • In vivo Transplantation Models: Bursal transplantation studies with ex vivo genetic modification allow assessment of NR13's function in the complex tissue environment, particularly its effects on stem cell populations .

For structural studies, advanced techniques like X-ray crystallography and NMR spectroscopy can be employed to determine the three-dimensional structure of NR13 and its complexes, though such studies are technically challenging due to the membrane association properties of Bcl-2 family proteins.

What is the significance of specific domains within NR13?

NR13 contains multiple functional domains that contribute to its anti-apoptotic activity:

  • BH4 Domain: This N-terminal domain is critical for anti-apoptotic function. Deletion of the BH4 domain converts NR13 from a death inhibitor to a death promoter. When DT40 cells were transfected with BH4-deleted NR13, they showed increased susceptibility to serum withdrawal-induced apoptosis compared to wild-type cells . The mechanism likely involves both protein-protein interactions and proper protein folding.

  • BH3 Domain: While NR13 contains a BH3 domain, it primarily interacts with the BH3 domains of pro-apoptotic proteins like Bax. Synthetic peptides containing the BH3 domain of Bax can bind to NR13 with high affinity and prevent its interaction with cytochrome c .

  • BH1 and BH2 Domains: These domains contain conserved motifs (NWGR in BH1, GGW in BH2) that are characteristic of anti-apoptotic Bcl-2 family members. These regions likely form a hydrophobic groove that interacts with BH3 domains from pro-apoptotic proteins .

  • Transmembrane Domain: Like other Bcl-2 family proteins, NR13 contains a C-terminal transmembrane domain that anchors it to intracellular membranes, particularly the mitochondrial outer membrane and endoplasmic reticulum .

To study domain function, researchers use site-directed mutagenesis to create specific domain deletions or point mutations, followed by functional assays in cellular or cell-free systems to assess changes in anti-apoptotic activity.

What are the optimal methods for producing recombinant NR13 protein for research?

Recombinant NR13 protein can be produced through several expression systems, with specific considerations for maintaining functional integrity:

  • E. coli Expression System: This is commonly used due to its simplicity and high yield. The NR13 coding sequence can be cloned into vectors like pET series with N-terminal or C-terminal tags for purification. Recombinant NR13 has been successfully expressed in E. coli as a highly soluble protein that maintains correct folding .

Critical parameters include:

  • Expression temperature (typically lowered to 16-20°C to enhance proper folding)

  • Induction conditions (IPTG concentration and duration)

  • Buffer composition during lysis and purification

  • Purification Strategy:

    • Affinity chromatography using His-tag or GST-tag fusion proteins

    • Ion-exchange chromatography for further purification

    • Size-exclusion chromatography as a final polishing step

  • Protein Validation:

    • Circular dichroism spectroscopy to verify secondary structure

    • Fluorescence spectroscopy to assess tertiary structure

    • Functional assays such as BH3 peptide binding or inhibition of caspase activation in cell-free systems

For functional studies, it's important to either include the transmembrane domain or develop strategies to maintain solubility of full-length protein. Some researchers use detergent micelles or liposomes to study membrane-associated forms of NR13.

How is NR13 research contributing to our understanding of avian B cell development?

NR13 research has provided significant insights into avian B cell development and the regulation of programmed cell death during immune system maturation:

  • Developmental Role: The inverse correlation between NR13 expression and apoptosis in the bursa suggests that NR13 is a key regulator of B cell survival during embryonic development. High NR13 levels in embryonic bursa likely protect developing B cells, while its reduction after hatching allows for appropriate apoptosis during B cell selection .

  • Stem Cell Maintenance: Bursal transplantation studies have demonstrated that NR13 can prevent the programmed elimination of bursal stem cells after hatching. When embryonic bursal cells transduced with NR13-expressing retroviruses were used in secondary transplantation experiments, they successfully reconstituted bursal follicles, unlike normal post-hatching bursal cells which lack stem cell potential .

The experiment showed:

  • 10-55% of follicles were reconstituted in secondary transplants using NR13-transduced cells

  • Control transplants using donor cells from 4-week normal bursa resulted in empty follicles

  • Western blot confirmed NR13 expression in secondary reconstituted follicles

  • Signaling Integration: NR13 appears to integrate signals from the microenvironment, as demonstrated by:

    • Rapid decrease in NR13 levels when bursal cell-cell contacts are disrupted

    • Induction by v-rel and PMA, which also protect against apoptosis

    • Inverse relationship with pro-apoptotic Bax levels

These findings contribute to our understanding of how programmed cell death is regulated during lymphoid development and the molecular mechanisms that maintain stem cell populations in primary lymphoid organs.

What are the most reliable assays to measure NR13 anti-apoptotic activity?

Several complementary assays are recommended to comprehensively evaluate NR13's anti-apoptotic function:

  • Cell Viability Assays:

    • Serum withdrawal in DT40 cells overexpressing NR13 vs. controls

    • Cell counting over 3-4 days to generate growth curves

    • MTT or similar colorimetric viability assays

    In published studies, NR13-overexpressing DT40 cells showed continued growth for 3-4 days under reduced serum conditions (1% chicken serum, no bovine calf serum), while control cells exhibited net cell death after 2 days .

  • Caspase Activation Assays:

    • Real-time monitoring using IncuCyte S3 with caspase 3/7 reagents

    • Quantification of green object count per well at various timepoints

    • Comparison between wild-type and NR13-knockout or overexpressing systems

  • TUNEL Assay:

    • Terminal deoxynucleotidyltransferase-mediated dUTP-biotin nick end labeling

    • Detects DNA fragmentation during apoptosis

    • Can be combined with immunofluorescence to identify NR13-expressing cells

  • Cell-free Biochemical Assays:

    • Xenopus egg extracts supplemented with purified recombinant NR13

    • Measurement of caspase-3 activation using fluorogenic substrates

    • Assessment of cytochrome c release from isolated mitochondria

  • BH3 Peptide Binding Assay:

    • Measures the interaction between NR13 and synthetic peptides containing BH3 domains

    • Monitored through changes in intrinsic tryptophan fluorescence

    • Can assess binding affinity and identify critical residues for interaction

For rigorous evaluation, multiple assays should be combined, and appropriate controls (including BH4-deleted NR13 as a pro-apoptotic control) should be included.

How does NR13 compare functionally and structurally to mammalian Bcl-2 family proteins?

NR13 shares several features with mammalian anti-apoptotic Bcl-2 family members but also has unique characteristics:

  • Structural Similarities:

    • Contains all four BH domains (BH1, BH2, BH3, BH4) characteristic of anti-apoptotic Bcl-2 proteins

    • Has conserved motifs in BH1 (NWGR) and BH2 (GGW) domains that are found in mammalian Bcl-2 family members

    • Contains a C-terminal transmembrane domain for membrane anchoring

  • Functional Conservation:

    • Inhibits apoptosis through interaction with pro-apoptotic proteins, similar to Bcl-2 and Bcl-xL

    • Localizes to mitochondria and endoplasmic reticulum

    • Regulates cytochrome c release from mitochondria

  • Unique Features:

    • NR13 appears to directly bind cytochrome c with high affinity, a property not well-characterized for mammalian Bcl-2 proteins

    • NR13's developmental regulation in the bursa represents a specialized role in avian B cell development

    • The BH4 domain of NR13 is particularly critical, as its deletion not only eliminates anti-apoptotic function but converts NR13 into a death agonist

  • Evolutionary Context:

    • NR13 appears to be avian-specific, though functionally similar proteins exist in other vertebrates (e.g., NRZ in zebrafish)

    • The viral homolog vNr-13 in HVT suggests evolutionary pressure to maintain this protein's function

Understanding these similarities and differences can provide insights into both conserved and species-specific mechanisms of apoptosis regulation across vertebrates.

What are the main technical challenges in studying NR13 and how can they be addressed?

Researchers face several technical challenges when studying NR13:

  • Limited Avian Research Tools:

    • Challenge: Fewer commercially available reagents for chicken proteins compared to mammalian systems

    • Solution: Develop custom antibodies against NR13, or use epitope tagging (FLAG, HA, etc.) in recombinant expression systems. For example, researchers have used custom rabbit polyclonal antibodies against specific NR13 peptides for Western blotting and immunoprecipitation .

  • Membrane Protein Solubility:

    • Challenge: Full-length NR13 contains a transmembrane domain that can cause aggregation during recombinant expression

    • Solution: Express truncated versions lacking the transmembrane domain for structural studies, or use detergents/lipid systems for full-length protein. In published studies, researchers have successfully produced soluble NR13 in E. coli that maintains correct folding .

  • Protein-Protein Interaction Detection:

    • Challenge: Transient or weak interactions can be difficult to capture

    • Solution: Use crosslinking agents before immunoprecipitation, or employ proximity labeling techniques like BioID. Coimmunoprecipitation with specific antibodies has successfully demonstrated the interaction between NR13 and Bax in DT40 cells .

  • Assessing In Vivo Function:

    • Challenge: Limited genetic manipulation tools for avian systems

    • Solution: Use retroviral transduction of primary cells followed by transplantation, as demonstrated in the bursal transplantation model where embryonic bursal cells were transduced with NR13-expressing retroviruses before transplantation into cyclophosphamide-treated recipients .

  • Distinguishing NR13 Effects from Other Bcl-2 Family Members:

    • Challenge: Functional redundancy among anti-apoptotic proteins

    • Solution: Use specific siRNA knockdown, or expression in systems where other family members are absent or inactive. Analysis of expression patterns showing that NR13 (but not Bcl-xL, A1, or Mcl1) correlates inversely with apoptosis during bursal development provides a natural system to distinguish NR13-specific effects .

What are emerging research directions for NR13 beyond its basic anti-apoptotic function?

Several cutting-edge research directions are expanding our understanding of NR13 beyond its canonical role:

  • Structural Biology Approaches:

    • High-resolution structural determination of NR13 alone and in complex with binding partners

    • Computational modeling of NR13 interactions with other proteins and membranes

    • Structure-based design of peptides or small molecules that can modulate NR13 function

  • Systems Biology Integration:

    • Comprehensive mapping of NR13 interactome using proximity labeling or mass spectrometry

    • Network analysis to position NR13 within broader cellular signaling pathways

    • Single-cell approaches to understand heterogeneity in NR13 expression and function

  • Non-apoptotic Functions:

    • Investigation of potential roles in cellular metabolism, as suggested for other Bcl-2 family members

    • Examination of NR13's impact on mitochondrial dynamics beyond apoptosis regulation

    • Potential involvement in cellular stress responses and autophagy

  • Comparative Immunology Applications:

    • Using NR13 as a model to understand evolutionary diversity in immune system development

    • Comparative studies between avian and mammalian B cell development mechanisms

    • Integration of NR13 research with broader questions in avian-specific immune adaptations

  • Vaccine Development and Viral Vector Design:

    • Understanding how viral homologs like vNr-13 contribute to vaccine efficacy

    • Engineering improved viral vectors by modulating NR13 homolog expression

    • The relationship between NR13 and Herpesvirus of turkeys (HVT) is particularly relevant, as HVT is widely used as a live vaccine against Marek's disease and as a recombinant vaccine viral vector for multiple avian diseases

These emerging directions represent opportunities for researchers to contribute novel insights to the field.

How can CRISPR/Cas9 and other modern genetic tools advance NR13 research?

CRISPR/Cas9 and other cutting-edge genetic tools offer powerful approaches to advance NR13 research:

  • Precise Genetic Manipulation:

    • Generation of NR13 knockout chicken cell lines to study loss-of-function effects

    • Domain-specific mutations to assess the importance of specific residues

    • Knock-in of tagged versions of NR13 at endogenous loci for physiological expression levels

  • Functional Genomics Approaches:

    • CRISPR screens to identify genes that modulate NR13 function

    • Creation of reporter systems where NR13 expression or activity is linked to fluorescent proteins

    • Precise editing of regulatory regions to study transcriptional control

  • In Vivo Applications:

    • Development of transgenic chicken models with modified NR13 expression

    • CRISPR-based approaches for generating germline-modified chickens

    • Recent advances in avian transgenesis using primordial germ cells have made genetic modification of chickens more accessible

  • Viral Genome Editing:

    • As demonstrated with vNr-13 in HVT, CRISPR/Cas9 allows precise deletion or modification of viral genes

    • The technique has been successfully used with nine combinations of gRNAs to delete exon 1 of vNr-13, creating deletion mutants with similar growth kinetics to wild-type virus but with specific defects in early virus growth and apoptosis inhibition

  • Temporal Control Systems:

    • Inducible CRISPR systems (e.g., dCas9 with inducible promoters) to control NR13 expression at specific developmental timepoints

    • Optogenetic or chemically-induced proximity systems to study NR13 interaction dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.