Recombinant Chicken Apoptosis regulator Bcl-2 (BCL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
BCL2; BCL-2; Apoptosis regulator Bcl-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPAPAPAAAPAAVAAAGASSH HRPEPPGSAAASEVPPAEGLRPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTA HGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIATWMTEYLNRHLH NWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
Uniprot No.

Target Background

Function
Recombinant Chicken Apoptosis regulator Bcl-2 (BCL2) suppresses apoptosis in diverse cell systems, including factor-dependent lymphohematopoietic and neural cells. It regulates cell death by modulating mitochondrial membrane permeability and appears to function within a feedback loop with caspases. BCL2 inhibits caspase activity by either preventing cytochrome c release from the mitochondria or by binding to the apoptosis-activating factor (APAF-1).
Gene References Into Functions
  1. Decreased mitochondrial Bcl-2 levels observed during maturation. PMID: 17133357
Database Links
Protein Families
Bcl-2 family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
In adult chicken expressed, in thymus, spleen, kidney, heart, ovary and brain, with the highest levels in the thymus. In the embryo, highly levels expressed in all tissues with high levels in the bursa of Fabricius.

Q&A

What is chicken apoptosis regulator BCL-2 and what is its function?

Chicken apoptosis regulator BCL-2 is an anti-apoptotic protein that plays a crucial role in regulating cell survival and preventing apoptosis. It belongs to the BCL-2 family, which is involved in controlling programmed cell death through regulation of mitochondrial membrane permeability and cytochrome c release. BCL-2 inhibits apoptosis by binding to pro-apoptotic proteins such as BAX and BAD, preventing the activation of caspases and subsequent cell death . Initially identified in blood lymphocytes, BCL-2 maintains cell survival through multiple mechanisms, including regulation of the mitochondrial pathway, antioxidant effects, inhibition of calcium ion flow across membranes, and regulation of ion channel protein function .

How does chicken BCL-2 compare structurally and functionally to mammalian BCL-2 proteins?

Chicken BCL-2 shares significant structural and functional homology with mammalian BCL-2 proteins, particularly in its core anti-apoptotic functions. Like its mammalian counterparts, chicken BCL-2 contains key domains including the BH (BCL-2 homology) domains and a C-terminal transmembrane domain that anchors it to intracellular membranes. The transmembrane domain (TMD) of BCL-2 is particularly important for proper localization and function, as evidenced by recent findings on TMD-TMD interactions in apoptosis regulation .

Both chicken and mammalian BCL-2 proteins exert their anti-apoptotic effects by interacting with pro-apoptotic proteins, preventing mitochondrial outer membrane permeabilization, and blocking cytochrome c release. This conservation of function makes chicken BCL-2 a valuable model for studying apoptotic regulation across species. The chicken BCL-2 gene (Gene ID: 396282, UniProt ID: Q00709) encodes a protein that functions similarly to mammalian versions in inhibiting the apoptotic pathway .

What expression systems are most effective for producing recombinant chicken BCL-2?

For successful production of recombinant chicken BCL-2, bacterial expression systems (particularly E. coli) are commonly used for initial studies, though eukaryotic expression systems often yield properly folded protein with appropriate post-translational modifications. When selecting an expression system, researchers should consider:

  • Protein solubility challenges: BCL-2 contains a hydrophobic transmembrane domain which can cause aggregation. Using fusion tags (such as GST, MBP, or SUMO) can improve solubility.

  • Post-translational modifications: If studying functional interactions that require phosphorylation or other modifications, mammalian cell lines (HEK293, CHO) or insect cell systems (Sf9, Hi5) are preferable.

  • Purification strategy: The addition of affinity tags (His-tag, FLAG) facilitates purification through affinity chromatography, as demonstrated in validated procedures for recombinant rat BCL-2 using discontinuous SDS-PAGE with 5% enrichment gel and 15% separation gel .

For structural studies requiring high protein yields, bacterial systems optimized with reduced temperature during induction and specialized media formulations can be effective. For functional studies, mammalian expression systems that maintain proper protein folding and modification are recommended.

What are the recommended protocols for detecting recombinant chicken BCL-2 in experimental samples?

Detection of recombinant chicken BCL-2 can be accomplished through several validated techniques:

Western Blot Analysis:

  • Use a validated antibody like the rabbit polyclonal antibody specific for chicken BCL-2 at a working dilution of 1:1000

  • Secondary detection with anti-rabbit IgG (typically at 1:50000 dilution)

  • Expected molecular weight band: approximately 26-27 kDa (similar to observed 27 kDa band for mammalian BCL-2)

  • Include positive controls from tissues known to express BCL-2 (e.g., chicken lymphoid tissues)

Immunohistochemistry/Immunofluorescence:

  • Fixation with 4% paraformaldehyde or formalin (10-15 minutes)

  • Permeabilization with 0.1-0.5% Triton X-100

  • Blocking with 3-5% BSA or 5-10% normal serum

  • Primary antibody incubation: Anti-chicken BCL-2 (1:100-1:500 dilution)

  • For immunofluorescence: Use appropriate fluorophore-conjugated secondary antibodies

ELISA:

  • Coat plates with capture antibody specific for chicken BCL-2

  • Use purified recombinant chicken BCL-2 to generate a standard curve

  • Employ a detection antibody with specificity for an alternate epitope

  • Validate with both positive and negative control samples

For all detection methods, it's crucial to validate antibody specificity using appropriate controls and to optimize protocols for specific experimental conditions and sample types.

How can researchers effectively study BCL-2 transmembrane domain interactions in apoptosis regulation?

Recent research highlights the importance of transmembrane domain (TMD) interactions in BCL-2 family proteins for apoptosis regulation. To study these interactions effectively:

Split Luciferase Assay:

  • A highly-specific split luciferase assay has been developed to analyze TMD interactions of BCL-2 family proteins in living cells

  • This technique enables detection of direct interactions between the TMDs of pro-apoptotic proteins (like BOK) and anti-apoptotic proteins (like BCL-2)

  • The assay involves fusion of complementary luciferase fragments to the TMDs of interest, with reconstitution of luciferase activity indicating interaction

Molecular Dynamics Simulations:

  • Computational approaches can predict key residues involved in TMD-TMD interactions

  • These predictions can be verified through site-directed mutagenesis of identified contact residues

  • For example, mutations of specific BCL-2-TMD residues (I/A, LV/AA, VI/AA, and LVI/AAA) have been shown to significantly reduce interaction with BOK-TMD

Functional Validation:

  • Combine interaction studies with functional apoptosis assays

  • Annexin-V staining coupled with flow cytometry can assess the impact of TMD mutations on BCL-2's ability to inhibit BOK-induced apoptosis

  • siRNA knockdown or CRISPR/Cas9-mediated knockout of BCL-2 can reveal its role in regulating BOK-induced cell death

This methodological approach integrating biophysical interaction studies with functional assays provides robust evidence for the role of TMD interactions in apoptosis regulation.

What are the optimal conditions for studying recombinant chicken BCL-2 interactions with other Bcl-2 family proteins?

To study interactions between recombinant chicken BCL-2 and other BCL-2 family proteins:

Buffer and Environmental Conditions:

ParameterRecommended ConditionRationale
BufferPhosphate Buffered Saline with 50% Glycerol and 0.5% BSAMaintains protein stability while reducing non-specific interactions
pH7.2-7.4Physiological pH optimizes native protein interactions
Temperature25°C for initial screening, 37°C for physiological relevanceDifferent temperatures can reveal temperature-dependent interactions
Salt concentration150 mM NaCl (physiological)Higher salt concentrations can disrupt electrostatic interactions

Experimental Approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-chicken BCL-2 antibodies for pull-down experiments

    • Verify interactions through Western blot analysis of co-precipitated proteins

    • Include appropriate controls (IgG control, reverse Co-IP)

  • Microscale Thermophoresis (MST) or Isothermal Titration Calorimetry (ITC):

    • For quantitative assessment of binding affinities between purified proteins

    • Allow determination of binding constants and thermodynamic parameters

  • Cellular Assays:

    • Employ the split luciferase assay for detecting protein-protein interactions in living cells

    • Use confocal microscopy to visualize co-localization of fluorescently tagged proteins

    • Validate functional relevance through apoptosis assays following mutation of interaction interfaces

When studying BCL-2 interactions with pro-apoptotic proteins like BOK, BAX, or BAK, it's important to consider both the canonical BH3 domain:hydrophobic groove interactions and the non-canonical TMD-TMD interactions, as both contribute to apoptosis regulation .

How can mutations in chicken BCL-2 transmembrane domain inform understanding of apoptosis regulation mechanisms?

Mutations in the transmembrane domain (TMD) of chicken BCL-2 provide valuable insights into apoptosis regulation mechanisms:

Structure-Function Relationship Analysis:
Recent research on BCL-2 family proteins demonstrates that TMD interactions represent a critical regulatory interface for apoptosis control. Specific mutations in the BCL-2 TMD can disrupt its interaction with pro-apoptotic proteins like BOK, significantly impairing BCL-2's ability to inhibit apoptosis . For example, mutation of key residues in the BCL-2-TMD (I/A, LV/AA, VI/AA, or LVI/AAA) reduces interaction with BOK-TMD by 68-90% and correspondingly diminishes BCL-2's inhibition of BOK-induced apoptosis .

Methodological Approach for Mutation Studies:

  • Identification of key residues: Use molecular dynamics simulations to predict critical residues in the TMD interaction interface

  • Site-directed mutagenesis: Generate specific mutations at predicted contact sites

  • Interaction verification: Employ split luciferase assays to quantify the impact of mutations on protein-protein interactions

  • Functional validation: Assess the effect of mutations on apoptosis inhibition using flow cytometry with Annexin-V staining

This research approach reveals that the conventional model of BCL-2 family regulation focusing solely on BH3 domain:hydrophobic groove interactions is incomplete. The TMD represents an additional regulatory interface that contributes significantly to apoptosis control and could serve as a novel target for therapeutic intervention in diseases with dysregulated apoptosis .

What are the most effective approaches for studying the role of chicken BCL-2 in the PI3K/Akt pathway?

The PI3K/Akt pathway interacts with BCL-2 family proteins in regulating cell survival and apoptosis. To study chicken BCL-2's role in this pathway:

Experimental Design Strategy:

  • Pathway Manipulation:

    • Use specific inhibitors (LY294002 for PI3K, MK-2206 for Akt)

    • Employ activators (insulin, growth factors) to stimulate the pathway

    • Utilize constitutively active or dominant negative constructs of pathway components

  • Readout Methodologies:

    • Western blotting to monitor phosphorylation status of Akt and BCL-2

    • qRT-PCR to measure transcriptional changes in BCL-2 expression

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the BCL-2 promoter

Contextual Models:
Research has demonstrated that in chicken tubular cells, modulation of the PI3K/Akt pathway influences BCL-2 family proteins during toxic exposure. For example, nickel chloride-induced apoptosis involves regulation of BCL-2 expression through the PI3K/Akt pathway . This model system provides a framework for studying:

  • How phosphorylation of BCL-2 by Akt affects its anti-apoptotic function

  • Whether PI3K/Akt activation alters BCL-2 localization or protein-protein interactions

  • The comparative response of BCL-2 regulation between mammalian and avian models

For comprehensive analysis, integrate pharmacological approaches with genetic manipulation (siRNA, CRISPR/Cas9) and analyze both immediate signaling events and downstream apoptotic outcomes through complementary methodologies.

How can researchers distinguish between BH3 domain-dependent and transmembrane domain-dependent interactions of chicken BCL-2?

Distinguishing between BH3 domain-dependent and transmembrane domain (TMD)-dependent interactions requires careful experimental design:

Differential Binding Analysis:

Interaction TypeExperimental ApproachExpected Outcome
BH3 domain-dependentBH3 mimetics (e.g., ABT-199, ABT-737)Disruption of BH3:hydrophobic groove interactions without affecting TMD interactions
TMD-dependentTMD peptide competition assaysSpecific inhibition of TMD-mediated interactions
Combined interactionsMutations in both domainsAdditive or synergistic effects on binding and function

Methodological Strategies:

  • Domain-specific mutations:

    • Introduce point mutations in the BH3-binding groove of BCL-2

    • Create separate constructs with mutations in the TMD region

    • Compare effects on protein interactions and function

  • Domain swap experiments:

    • Generate chimeric proteins by swapping TMDs between different BCL-2 family members

    • Assess whether specificity of interactions and functional outcomes follows the BH3 domain or the TMD

  • Split luciferase assay optimization:

    • Use the highly-specific split luciferase assay to specifically measure TMD interactions

    • Compare results with co-immunoprecipitation data reflecting total protein interactions

Recent research has identified a "double-bolt lock" mechanism where both BH3 domain and TMD interactions contribute to binding affinity between certain BCL-2 family proteins . This highlights the importance of analyzing both interaction interfaces when studying BCL-2 function in apoptosis regulation.

What techniques are recommended for analyzing chicken BCL-2 oligomerization and its functional significance?

BCL-2 family proteins can form homotypic and heterotypic oligomers that influence their function in apoptosis regulation. To analyze chicken BCL-2 oligomerization:

Biochemical Approaches:

  • Chemical Cross-linking:

    • Use membrane-permeable crosslinkers (e.g., DSP, DSS) to capture transient protein-protein interactions

    • Analyze oligomeric species by SDS-PAGE and immunoblotting

    • Vary crosslinker concentration and reaction time to capture different oligomeric states

  • Blue Native PAGE:

    • Separate native protein complexes while preserving their oligomeric state

    • Compare patterns before and after apoptotic stimuli or in different cellular compartments

  • Size Exclusion Chromatography:

    • Fractionate protein complexes based on their hydrodynamic radius

    • Combine with multi-angle light scattering (SEC-MALS) for accurate molecular weight determination

Advanced Imaging Techniques:

  • Förster Resonance Energy Transfer (FRET):

    • Tag BCL-2 with appropriate fluorophore pairs

    • Measure energy transfer as an indicator of protein proximity

    • Use acceptor photobleaching or fluorescence lifetime imaging for quantification

  • Fluorescence Correlation Spectroscopy (FCS):

    • Analyze diffusion properties to detect changes in molecular size

    • Particularly useful for membrane-associated proteins like BCL-2

Computational Modeling:
Molecular dynamics simulations can reveal potential oligomerization interfaces and stable oligomeric structures. Recent research using this approach has demonstrated that BCL-2 TMD can form higher-order oligomers with functional significance in apoptosis regulation . These simulations can guide experimental design by identifying key residues for mutation studies.

The functional significance of oligomerization can be assessed by correlating oligomeric state with anti-apoptotic activity through Annexin-V staining, caspase activity assays, or cytochrome c release measurements.

What are common challenges when working with recombinant chicken BCL-2 and how can they be addressed?

Working with recombinant chicken BCL-2 presents several technical challenges that researchers should anticipate:

Challenge: Protein Aggregation and Insolubility

  • Cause: The hydrophobic transmembrane domain (TMD) of BCL-2 tends to promote aggregation

  • Solution:

    • Express truncated versions without the TMD for initial studies

    • Use solubility-enhancing tags (MBP, SUMO, GST)

    • Include mild detergents (0.1% Triton X-100, 0.5% CHAPS) in purification buffers

    • Add 5-10% glycerol to stabilize the protein in solution

Challenge: Low Expression Yields

  • Cause: Toxicity to expression host due to BCL-2's anti-apoptotic activity

  • Solution:

    • Use tightly regulated expression systems (e.g., T7lac promoter with glucose repression)

    • Optimize codon usage for the expression host

    • Lower induction temperature (16-20°C)

    • Consider insect cell expression systems for higher yields

Challenge: Antibody Cross-Reactivity

  • Cause: Sequence conservation between chicken and mammalian BCL-2

  • Solution:

    • Validate antibody specificity using knockout controls

    • Use epitope-tagged versions for detection with anti-tag antibodies

    • Select antibodies raised against chicken-specific epitopes

Challenge: Functional Validation Issues

  • Cause: Context-dependent activity of BCL-2

  • Solution:

    • Use multiple cell types to verify observations

    • Compare results across different apoptotic stimuli

    • Include appropriate positive and negative controls in each experiment

    • Validate interactions through multiple complementary techniques

How can researchers optimize detection of chicken BCL-2 interactions with pro-apoptotic proteins like BOK?

Detecting and characterizing interactions between chicken BCL-2 and pro-apoptotic proteins requires optimization of several parameters:

Optimizing Cellular Assays:

  • Split Luciferase Assay Enhancement:

    • Normalize signals to account for protein expression levels

    • Include appropriate positive controls (known interacting pairs) and negative controls

    • When studying BOK-TMD and BCL-2-TMD interactions, use BAX-TMD/TOM5-TMD as a negative control for comparison

    • Optimize the linker length between the protein of interest and luciferase fragments

  • Co-localization Studies:

    • Use confocal laser scanning microscopy (cLSM) to verify proper subcellular localization

    • Employ super-resolution techniques (STED, PALM, STORM) for more detailed interaction analysis

    • Confirm that mutations used to study interactions do not alter subcellular localization

Biochemical Approach Optimization:

  • Co-immunoprecipitation:

    • Use mild lysis conditions to preserve membrane-associated protein interactions

    • Cross-link proteins prior to lysis when studying transient interactions

    • Include appropriate detergents (0.5-1% CHAPS, 1% Digitonin) that maintain native protein conformations

  • In vitro Binding Assays:

    • Purify proteins in detergent micelles or nanodiscs to maintain native membrane protein structure

    • Control for non-specific binding using irrelevant proteins of similar hydrophobicity

    • Vary buffer conditions (salt, pH) to identify optimal interaction parameters

Signal Enhancement Strategies:

  • For flow cytometry detection of apoptosis in BOK-BCL-2 interaction studies, optimize transfection efficiency to ensure sufficient expression

  • Consider that BOK overexpression is generally less efficient than overexpression of other Bcl-2 proteins

  • Allow sufficient time for protein expression and interaction (typically 18-42 hours post-transfection)

What data validation approaches are essential when studying chicken BCL-2's role in apoptosis regulation?

Robust data validation is critical for research on chicken BCL-2's role in apoptosis regulation:

Orthogonal Methodology Validation:

MeasurementPrimary MethodValidation Method
Protein-protein interactionsSplit luciferase assayCo-immunoprecipitation or FRET
Apoptosis inductionAnnexin-V stainingCaspase activity assays or TUNEL
BCL-2 expressionWestern blotqRT-PCR or immunofluorescence
Subcellular localizationConfocal microscopySubcellular fractionation

Genetic Manipulation Controls:

  • Gene Silencing Validation:

    • Confirm knockdown efficiency by Western blot

    • Include scrambled siRNA controls

    • Use multiple siRNA sequences targeting different regions of BCL-2 mRNA

  • Knockout Verification:

    • Validate CRISPR/Cas9-mediated knockout by sequencing and protein expression analysis

    • Use multiple guide RNAs to control for off-target effects

    • Perform rescue experiments with wild-type and mutant BCL-2

Statistical Analysis Requirements:

  • Perform experiments with sufficient biological replicates (minimum n=3)

  • Apply appropriate statistical tests based on data distribution

  • Report effect sizes along with p-values

  • Consider blinding analysis when applicable

Functional Validation Approaches:

  • Combine molecular interaction data with functional apoptosis assays

  • Verify that mutation of BCL-2 TMD affects both interaction (using split luciferase assay) and function (using apoptosis assays)

  • Test observations across multiple cell types and apoptotic stimuli to ensure generalizability

What are the emerging research directions for chicken BCL-2 in comparative apoptosis studies?

The study of chicken BCL-2 in comparative apoptosis research continues to evolve, offering valuable insights into conserved and divergent mechanisms of cell death regulation across species. Several promising research directions are emerging:

Evolutionary Conservation of Regulatory Mechanisms:
Recent discoveries about transmembrane domain interactions in mammalian BCL-2 family proteins suggest similar mechanisms may exist in avian systems. Comparative studies between chicken and mammalian BCL-2 can illuminate evolutionary conservation of these newly identified regulatory interfaces . This evolutionary perspective may reveal fundamental apoptotic control mechanisms that have been preserved across vertebrate lineages.

Species-Specific Regulation and Adaptation:
Chicken-specific aspects of BCL-2 regulation may represent adaptations to unique physiological demands or environmental pressures. Understanding these species-specific features could provide insights into tissue-specific apoptosis regulation in development and disease. The PI3K/Akt pathway's influence on chicken BCL-2 in response to environmental toxins represents one example of this research direction .

Translational Applications:
Insights from chicken BCL-2 studies may inform therapeutic approaches for both veterinary and human medicine. The identification of TMD interactions as critical for apoptosis regulation presents a novel potential drug target beyond the traditional BH3-mimetic approach . Comparative studies can help identify which regulatory mechanisms are most amenable to therapeutic intervention across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.