Recombinant Chicken Blood vessel epicardial substance (BVES)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
BVES; POP1; POPDC1; Blood vessel epicardial substance; Popeye domain-containing protein 1; Popeye protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
BVES
Target Protein Sequence
MDTTAISPLTPLGVIPDLKNATSVPFNETACENWKEIHHLVFHVANICFAAGLVIPTTLN LHMIFLRGLLTVGCALFIIWATLYRCALDIMIWNSVFLVVNLLHFIYLVYKRRPIKIEKE LSSLYKRMFEPLHVPPELFQRLTGQFCNIQTLKTGQAYAAEDKTSVDDRLSILLKGKMKV SYRGHFLHNIYPCAFIDSPEFRSTQMNRGEKFQVTIIADDNCKFLCWSRERLTYFLETEP FLYEIFKYLIGKDITNKLYSLNDPTLNDKASKKIDRQPSLCSQLSVMQMRNSMASTSDSE DGLQMFLRGTSSSSSLRPGRTSPYLRTSAKMKPIEESVEDDVFEAPSAEKLELQRLP
Uniprot No.

Target Background

Function

Blood vessel epicardial substance (BVES) is a cell adhesion molecule crucial for maintaining cell integrity. It plays a vital role in forming and regulating the tight junction (TJ) paracellular permeability barrier in epithelial cells. BVES initiates primordial cell adhesion and aggregation in a calcium-independent manner, influencing epithelial movement during corneal development and regeneration. Further, it may be involved in VAMP3-mediated vesicular transport and receptor recycling, potentially regulating cell shape and movement through Rho-GTPase modulation. Its involvement in skeletal muscle and heart development, heart function maintenance, striated muscle regeneration, and cell spreading regulation has also been suggested.

Gene References Into Functions
  1. This study was the first to demonstrate BVES's role in epithelia, supporting its contribution to maintaining epithelial cell integrity. PMID: 16188940
  2. This research showed similar mRNA and protein expression patterns of Popdc1 in the cardiac mesoderm during embryogenesis. PMID: 16444735
Database Links
Protein Families
Popeye family
Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma. Membrane, caveola.
Tissue Specificity
Expressed in the heart and skeletal muscle (at protein level). Isoform 1 and isoform 4: expressed in heart, muscle, brain, stomach, kidney, lung and spleen.

Q&A

What is Blood Vessel Epicardial Substance (BVES) and what are its primary biological functions?

Blood Vessel Epicardial Substance (BVES, also known as POPDC1) is a tight junction-associated transmembrane protein originally discovered from a cDNA screen of the developing heart. BVES belongs to the Popeye gene family, named for its high-level expression in heart and other muscle lineages . Although BVES has no sequence similarity to other gene families, research has demonstrated that it plays critical roles in:

  • Maintaining intestinal epithelial integrity

  • Regulating junctional-associated Wnt signaling

  • Preserving epithelial phenotypes

  • Suppressing tumorigenesis

  • Contributing to intestinal stem cell signaling and crypt proliferation

BVES has been shown to regulate several molecular pathways, including cAMP and WNT signaling, while also promoting the degradation of the oncogene c-Myc .

How is recombinant Chicken BVES typically produced for research applications?

Recombinant Chicken BVES is typically produced in mammalian cell expression systems. According to standardized protocols, the recombinant protein is expressed with a His-tag for purification purposes . The general production process involves:

  • Cloning the full-length or partial-length BVES gene sequence from chicken (Gallus gallus) into an appropriate expression vector

  • Transfecting mammalian cells with the expression construct

  • Inducing protein expression under controlled conditions

  • Harvesting and lysing cells to release the recombinant protein

  • Purifying the His-tagged BVES protein using affinity chromatography

  • Formulating the purified protein in PBS buffer

The resulting protein preparation typically achieves >80% purity as determined by analytical methods and contains <1.0 EU per μg endotoxin levels as measured by the LAL method .

What detection methods are available for studying Chicken BVES in experimental systems?

Multiple detection methodologies have been established for studying Chicken BVES:

Detection MethodApplicationAdvantagesConsiderations
Monoclonal antibodiesWestern blotting, ImmunofluorescenceHigh specificity, Versatile applicationsMay have epitope-specific limitations
ELISAProtein quantificationHigh-throughput capabilityRequires specific antibodies
RT-PCRGene expression analysisSensitive detection of transcript levelsDoes not measure protein abundance
ImmunohistochemistryTissue localizationIn situ detection capabilitiesMay require optimization for fixation

Specifically, monoclonal antibodies such as 3F11-D9-E8 and 1B3-G11-A8 have been developed that can detect both recombinant BVES in ELISAs and endogenous chicken BVES in tissue extracts by Western blotting . These antibodies also allow for immunofluorescence detection of BVES in tissues such as cardiomyocytes of embryonic chicken hearts .

How should experiments be designed to investigate BVES function in intestinal epithelial integrity?

Designing robust experiments to study BVES function in intestinal epithelial integrity requires a systematic approach addressing multiple variables:

Experimental design steps:

  • Define variables precisely:

    • Independent variable: BVES expression levels (wildtype vs. knockout/knockdown)

    • Dependent variables: Epithelial barrier function parameters, stem cell compartment metrics, proliferation markers

    • Control variables: Animal age, genetic background, housing conditions

  • Formulate specific hypotheses:

    • Null hypothesis (H0): BVES deletion does not affect intestinal epithelial integrity

    • Alternative hypothesis (H1): BVES deletion compromises intestinal epithelial integrity

  • Implement appropriate controls:

    • Use wildtype (WT) animals from the same genetic background as Bves–/– models

    • Include sham treatments when testing response to injury models

    • Consider littermate controls to minimize genetic variability

  • Measurement approaches:

    • In vivo models: Compare Bves–/– mice with WT controls for baseline intestinal morphology, including crypt height and proliferation markers

    • Ex vivo models: Establish 3D-crypt cultures (enteroids) from both genotypes to assess stemness markers

    • Challenge models: Test responses to radiation injury or pathogen exposure (e.g., Citrobacter rodentium)

  • Analytical methods:

    • Quantify crypt viability, proliferation rates, and stem cell marker expression

    • Measure epithelial barrier permeability using fluorescent tracers

    • Assess Wnt pathway activation through reporter assays or target gene expression analysis

Previous studies have demonstrated that Bves–/– small intestine shows increased crypt height, proliferation, and expression of stem cell markers compared to wildtype mice at baseline, with amplified Wnt signaling in ex vivo enteroid cultures .

What methodological considerations are important when investigating the role of BVES in response to intestinal injury?

When studying BVES function in injury response models, several methodological considerations are crucial:

  • Radiation injury models:

    • Carefully calibrate radiation dosage to induce sub-lethal intestinal injury

    • Monitor BVES expression dynamics after radiation in wildtype animals

    • Compare crypt survival, proliferation, and regeneration between Bves–/– and WT animals

    • Analyze expression of damage-responsive stem cell markers such as Bmi1 and TERT

  • Pathogen challenge models:

    • Select appropriate pathogens (e.g., Citrobacter rodentium) that affect epithelial integrity

    • Standardize inoculation protocols and pathogen loads

    • Quantify colonization rates, tissue damage, and inflammatory responses

    • Measure barrier function through permeability assays

  • Data collection and analysis:

    • Implement blinding procedures during histological analysis

    • Use multiple measurement time points (acute vs. recovery phases)

    • Consider sex-based differences in injury response

    • Analyze stemness markers (Lgr5, Ascl2) and damage-responsive stem cell populations

Research has shown that Bves–/– mice demonstrate greater small intestinal crypt viability and proliferation after radiation compared to WT mice, along with elevations in stem cell markers and amplified Wnt signaling .

What approaches can be used to study BVES interaction with signaling pathways like Wnt?

Investigating BVES interactions with signaling pathways requires integrated experimental approaches:

  • Molecular interaction studies:

    • Co-immunoprecipitation assays to detect physical interactions between BVES and Wnt pathway components

    • Proximity ligation assays to visualize protein-protein interactions in situ

    • FRET/BRET techniques to analyze real-time interactions in living cells

  • Pathway activity measurements:

    • TOPFlash/FOPFlash reporter assays to quantify canonical Wnt pathway activation

    • Immunoblotting for phosphorylated β-catenin levels

    • Nuclear translocation assays for β-catenin

    • qRT-PCR for Wnt target genes like Axin2, Lgr5, and Ascl2

  • Genetic rescue experiments:

    • Re-introduction of wildtype BVES into knockout systems

    • Creation of domain-specific mutants to map interaction sites

    • Combined knockdown/knockout of BVES and Wnt pathway components

  • Systems biology approaches:

    • RNA-seq analysis of BVES-deficient vs. wildtype tissues

    • ChIP-seq to identify genomic regions affected by BVES-mediated Wnt signaling

    • Proteomics to identify the BVES interactome

Studies have demonstrated that BVES regulates junctional-associated Wnt signaling, which is critical for intestinal stem cell signaling, crypt proliferation, and regeneration .

What are the optimal procedures for producing and validating monoclonal antibodies against Chicken BVES?

The production and validation of monoclonal antibodies against Chicken BVES requires rigorous methodology:

  • Antigen preparation:

    • Express recombinant Chicken BVES in mammalian expression systems

    • Purify the protein using affinity chromatography (His-tag)

    • Validate protein identity by mass spectrometry or N-terminal sequencing

    • Assess purity by SDS-PAGE

  • Immunization and hybridoma generation:

    • Immunize mice with purified recombinant BVES

    • Harvest B cells from immunized mice

    • Fuse B cells with myeloma cells to create hybridomas

    • Screen hybridoma supernatants for antibody production

  • Antibody selection and validation:

    • Perform initial screening by ELISA against recombinant BVES

    • Test positive clones by Western blotting using both recombinant protein and native tissue extracts

    • Validate by immunofluorescence on tissues known to express BVES (e.g., cardiomyocytes)

    • Determine antibody isotype and purify from hybridoma supernatants

  • Characterization of antibody properties:

    • Map epitope binding regions when possible

    • Determine sensitivity and specificity parameters

    • Test cross-reactivity with BVES from other species

    • Optimize working concentrations for different applications

Previous studies successfully generated two BVES-specific monoclonal antibodies (3F11-D9-E8 and 1B3-G11-A8) that demonstrated specificity in ELISA, Western blotting, and immunofluorescence applications .

How can three-dimensional organoid culture systems be optimized for studying BVES function?

Organoid culture systems provide powerful tools for investigating BVES function in a controlled environment that recapitulates tissue architecture:

  • Establishment of 3D-crypt cultures (enteroids):

    • Isolate intestinal crypts from Bves–/– and WT mice using established protocols

    • Culture in Matrigel with appropriate growth factors (EGF, Noggin, R-spondin)

    • Optimize culture conditions for each genotype, as BVES-deficient enteroids may exhibit different growth characteristics

  • Phenotypic assessment:

    • Measure enteroid formation efficiency and growth rate

    • Analyze budding patterns and organoid morphology

    • Quantify stem cell compartment size using reporter lines (e.g., Lgr5-EGFP)

    • Assess proliferation using EdU or BrdU incorporation

  • Molecular characterization:

    • Analyze expression of stem cell markers (Lgr5, Ascl2)

    • Measure "CBC" and "+4" stem cell markers

    • Quantify Wnt pathway activity

    • Perform single-cell RNA sequencing to identify cell populations affected by BVES deficiency

  • Functional assays:

    • Challenge organoids with stressors (radiation, hypoxia, inflammatory cytokines)

    • Test barrier function using fluorescent tracers

    • Perform live imaging to track cell behavior and organoid development

    • Conduct gene editing in organoids to manipulate BVES expression

Research has shown that ex vivo 3D-crypt cultures of Bves–/– enteroids demonstrate increased stemness compared to WT, along with increased proliferation, expression of stem cell markers, and amplified Wnt signaling .

What storage and handling protocols are recommended for recombinant Chicken BVES?

Proper storage and handling of recombinant Chicken BVES is critical for maintaining protein integrity and experimental reproducibility:

Storage ConditionRecommended ProtocolApplication
Short-term storageStore at +4°CFor immediate use within days
Long-term storageStore at -20°C to -80°CFor preservation over months/years
Buffer compositionPBS bufferMaintains protein stability
AliquotingDivide into single-use aliquotsPrevents freeze-thaw cycles
Thawing procedureThaw on ice graduallyPreserves protein structure

For long-term stability, it is advisable to store recombinant Chicken BVES at -20°C to -80°C, while short-term storage at +4°C is suitable for immediate use . The protein should be maintained in PBS buffer to ensure stability, and repeated freeze-thaw cycles should be avoided by preparing single-use aliquots.

What are the primary quality control parameters for assessing recombinant Chicken BVES preparations?

Quality control of recombinant Chicken BVES preparations should address multiple parameters:

  • Purity assessment:

    • SDS-PAGE followed by Coomassie staining (target: >80% purity)

    • HPLC analysis for higher resolution evaluation

    • Mass spectrometry to confirm protein identity

  • Functional validation:

    • Binding assays with known interaction partners

    • Structural integrity verification by circular dichroism

    • Activity assays where applicable

  • Contaminant testing:

    • Endotoxin testing using LAL method (<1.0 EU per μg)

    • Host cell protein quantification

    • DNA contamination assessment

  • Stability evaluation:

    • Accelerated stability studies at elevated temperatures

    • Long-term stability monitoring at recommended storage conditions

    • Freeze-thaw cycle tolerance testing

According to established protocols, recombinant Chicken BVES should achieve >80% purity and contain less than 1.0 EU per μg of endotoxin as determined by the LAL method to ensure experimental reliability .

How can BVES knockout models be effectively utilized to study intestinal epithelial homeostasis?

BVES knockout models provide valuable tools for investigating intestinal epithelial homeostasis:

  • Baseline phenotypic characterization:

    • Compare intestinal morphology between Bves–/– and WT mice

    • Quantify crypt height, villus length, and cell type distribution

    • Analyze proliferation patterns using Ki67 or PCNA staining

    • Measure stem cell compartment size using Lgr5-EGFP reporter mice

  • Molecular profiling:

    • Perform RNA-seq analysis to identify dysregulated pathways

    • Conduct proteomics to assess changes in protein expression

    • Analyze epigenetic modifications to identify alterations in chromatin structure

    • Map transcription factor binding profiles in knockout vs. wildtype tissues

  • Functional assays:

    • Assess epithelial barrier function using FITC-dextran permeability assays

    • Measure transepithelial electrical resistance (TEER)

    • Evaluate junction protein localization and complex formation

    • Test regenerative capacity following controlled injury

  • Interactome analysis:

    • Identify BVES-interacting proteins using immunoprecipitation followed by mass spectrometry

    • Validate key interactions using techniques like proximity ligation assay

    • Map the domains of BVES responsible for specific protein-protein interactions

Research has demonstrated that Bves–/– mice exhibit increased crypt height, proliferation, and stem cell marker expression compared to wildtype mice, suggesting altered intestinal epithelial homeostasis in the absence of BVES .

What experimental approaches are recommended for studying BVES in cancer models?

Investigating BVES in cancer models requires comprehensive experimental approaches:

  • Expression analysis in cancer tissues:

    • Compare BVES expression between tumor and adjacent normal tissues

    • Correlate expression levels with clinical parameters and patient outcomes

    • Analyze promoter methylation status to assess epigenetic regulation

    • Evaluate mutations or variants in the BVES gene in cancer samples

  • Functional studies in cancer cell lines:

    • Manipulate BVES expression through overexpression or knockdown approaches

    • Assess effects on proliferation, migration, invasion, and colony formation

    • Evaluate changes in epithelial-to-mesenchymal transition (EMT) markers

    • Test response to therapy in BVES-modified vs. control cells

  • In vivo cancer models:

    • Cross Bves–/– mice with tumor-prone models

    • Conduct carcinogen-induced cancer studies in BVES-deficient backgrounds

    • Perform orthotopic transplantation of BVES-modified cancer cells

    • Track tumor initiation, progression, and metastasis

  • Molecular mechanism investigations:

    • Analyze WNT pathway activation in BVES-deficient tumors

    • Quantify c-Myc levels and stability

    • Assess cAMP signaling dynamics

    • Investigate junction protein complex formation and stability

Studies have shown that BVES is suppressed in gastrointestinal cancers, and mouse modeling has demonstrated that loss of BVES promotes tumor formation, suggesting its potential role as a tumor suppressor .

What are the current advances in understanding BVES role in intestinal response to radiation injury?

Recent research has revealed important insights into BVES function during radiation injury response:

  • Expression dynamics:

    • BVES expression is downregulated after radiation in wildtype small intestine

    • This downregulation may represent a natural response mechanism to facilitate regeneration

  • Protective effects in knockout models:

    • Bves–/– mice demonstrate significantly greater small intestinal crypt viability after radiation

    • Enhanced proliferation is observed in BVES-deficient intestinal tissue following injury

    • These findings suggest that BVES may normally restrict regenerative responses

  • Stem cell population effects:

    • After radiation, Bves–/– mice show elevations in Lgr5 and Ascl2 expression

    • Damage-responsive stem cell populations marked by Bmi1 and TERT are increased

    • This indicates that BVES may regulate multiple stem cell populations during injury response

  • Signaling pathway involvement:

    • Amplified Wnt signaling is observed in Bves–/– mice after radiation

    • This suggests that BVES may modulate Wnt pathway activity during regenerative responses

    • Targeting this interaction could potentially enhance intestinal recovery after injury

These findings indicate that BVES plays a complex role in regulating intestinal epithelial regeneration following radiation injury, potentially through modulation of stem cell populations and Wnt signaling .

How do experimental designs need to be modified when studying BVES across different species models?

Cross-species investigation of BVES requires careful experimental design considerations:

  • Sequence homology analysis:

    • Compare BVES protein sequences across species to identify conserved domains

    • Target highly conserved regions for cross-species antibodies or probes

    • Design species-specific primers for gene expression analysis

    • Consider evolutionary relationships when interpreting functional differences

  • Expression pattern comparison:

    • Map BVES expression in equivalent tissues across species

    • Identify species-specific expression patterns that may indicate functional divergence

    • Use standardized quantification methods to enable direct comparison

    • Account for developmental timing differences between species

  • Functional conservation testing:

    • Perform cross-species rescue experiments (e.g., chicken BVES in mouse knockout)

    • Analyze protein-protein interactions with conserved binding partners

    • Compare signaling pathway modulation across species

    • Evaluate phenotypic effects of BVES disruption in multiple model organisms

  • Technical adaptations:

    • Optimize antibody dilutions for each species

    • Adjust fixation protocols for different tissue properties

    • Calibrate detection methods based on species-specific expression levels

    • Validate reference genes for qPCR across different species

Studies have successfully developed tools like monoclonal antibodies that specifically detect chicken BVES in various experimental contexts, enabling comparative studies between avian and mammalian models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.