Recombinant Chicken Cell cycle control protein 50A (TMEM30A)

What is the basic structure of chicken TMEM30A protein?

Chicken TMEM30A (also known as Cell cycle control protein 50A) is a 372-amino acid transmembrane protein with two transmembrane domains and an extracellular loop containing three cysteine residues and N-glycosylation sites . The protein structure includes specific domains that facilitate its interaction with P4-ATPases to form functional flippase complexes. When working with recombinant versions, the full-length protein (amino acids 1-372) is typically expressed with tags (such as His-tag) for purification purposes . The complete amino acid sequence of chicken TMEM30A is: MAVNYSAKEEADGHPAGGGPGGGATAGGGGAVKTRKPDNTAFKQQRLPAWQPILTAGTVLPAFFIIGLIFIPIGIGIFVTSNNIREYEIDYTGVEPSSPCNKCLNVSWDSTPPCTCTINFTLEHSFESNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDNSSLLNPSKECEPYRTNEDKPIAPCGAIANSMFNDTLELYHIENDTRTAITLIKKGIAWWTDKNVKFRNPKGDGNLTALFQGTTKPVNWPKPVYMLDSEPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSNLQPTLQAGKYSLNITYNYPVHSFDGRKRMILSTISWMGGKNPFLGIAYITVGSICFFLGVVLLIIHHKYGNRNTSADIPN .

How does chicken TMEM30A compare to human TMEM30A?

While both chicken and human TMEM30A proteins serve as β-subunits of P4-ATPase flippase complexes, there are notable differences in their amino acid sequences. Human TMEM30A consists of 361 amino acids with two transmembrane domains and a similar extracellular loop structure . Sequence alignment shows high conservation of functional domains between species, particularly in regions responsible for P4-ATPase interactions. The human TMEM30A sequence (MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAVGSISFLLGVVLLVINHKYRNSSNTADITI) differs in key regions that may affect binding specificity and functional outcomes in experimental systems .

What expression systems are optimal for producing recombinant chicken TMEM30A?

• For structural studies: E. coli systems with optimization for membrane protein expression

• For functional studies: Mammalian cell lines (HEK293, CHO) or insect cell systems (Sf9, Hi5)

• For interaction studies: Co-expression with relevant P4-ATPases may enhance stability and folding

The choice of expression system should align with research objectives, particularly when studying protein-protein interactions or enzymatic activities.

What is the primary function of TMEM30A in flippase complexes?

TMEM30A functions as an essential accessory component (β-subunit) of P4-ATPase flippase complexes that catalyze the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes . This process maintains asymmetric distribution of phospholipids across membrane bilayers, which is critical for numerous cellular functions. Specifically, TMEM30A is required for:

• Proper folding and assembly of the flippase complex

• ER to Golgi exit of the complex (particularly ATP8A2:TMEM30A)

• Formation of P-type ATPase intermediate phosphoenzymes including ATP8A2, ATP8B1, and ATP8B2

• Potentially assisting in the binding of phospholipid substrates

The β-subunit appears to be indispensable for the catalytic α-subunit (P4-ATPase) to function properly in translocating phospholipids across cellular membranes.

How does TMEM30A contribute to cellular migration and cancer progression?

TMEM30A plays a significant role in cell migration through its function within phospholipid flippase complexes. Research has demonstrated that:

• TMEM30A phospholipid flippase complexes facilitate the formation of membrane ruffles as a result of phospholipid translocation, which is a critical process in cell migration

• The ATP8A1-TMEM30A flippase complex is specifically involved in mediating cell migration

• Computational and experimental approaches have identified TMEM30A-regulated signaling networks involved in tumor migration

In cancer cells, such as hepatocellular carcinoma (SMMC-7721) and cervical adenocarcinoma (HeLa), overexpression of TMEM30A has been shown to affect migration-related gene expression . Additionally, ATP11A, which partners with TMEM30A, has been identified as a predictive marker for colorectal cancer prognosis, suggesting involvement of this flippase complex in cancer progression .

What role does TMEM30A play in metabolic regulation?

Conditional knockout studies in mice have revealed that TMEM30A is crucial for metabolic homeostasis, particularly in pancreatic islet function. When Tmem30a is specifically knocked out in pancreatic β cells, mice develop:

• Obesity

• Hyperglycemia

• Glucose intolerance

• Hyperinsulinemia

• Insulin resistance

These metabolic disruptions occur due to insufficient insulin release. Mechanistically, TMEM30A is essential for:

• Clathrin-mediated vesicle transport between the trans-Golgi network and plasma membrane

• Proper budding of insulin secretory granules

• Transport of glucose transporter 2 (Glut2) to the cell membrane

• Regulating phospholipid flippase activity required for membrane curvature during vesicle secretion

This illustrates TMEM30A's critical role beyond simple phospholipid translocation, extending to vesicle trafficking essential for hormone secretion and glucose homeostasis.

What purification strategies are recommended for recombinant chicken TMEM30A?

When purifying recombinant chicken TMEM30A, consider the following methodological approaches:

• Affinity chromatography: For His-tagged recombinant proteins, nickel or cobalt affinity columns provide efficient initial purification

• Size exclusion chromatography: Critical for separating monomeric from aggregated protein and removing contaminants

• Ion exchange chromatography: Can improve purity based on TMEM30A's isoelectric point

• Detergent selection: Critical for maintaining protein stability and native conformation; common choices include:

  • n-Dodecyl β-D-maltoside (DDM)

  • Digitonin

  • Lauryl maltose neopentyl glycol (LMNG)

• Buffer optimization: Phosphate or Tris buffers (pH 7.4-8.0) with glycerol (10-15%) and reducing agents help maintain stability

For functional studies, consider co-purification with relevant P4-ATPase partners to maintain the native complex structure and enhance stability.

How can researchers effectively study TMEM30A:P4-ATPase interactions?

To investigate interactions between TMEM30A and P4-ATPases, researchers should consider these methodological approaches:

• Co-immunoprecipitation: Using antibodies against either TMEM30A or the P4-ATPase of interest (ATP8A1, ATP8A2, ATP8B1, ATP8B2)

• Proximity ligation assays: For detecting interactions in intact cells with spatial resolution

• Fluorescence resonance energy transfer (FRET): By tagging TMEM30A and P4-ATPases with appropriate fluorophores

• Surface plasmon resonance: For quantitative binding kinetics using purified components

• Yeast two-hybrid screening: To identify specific interaction domains

• Co-expression systems: Expressing both components in the same cell system, as demonstrated with ATP11A and TMEM30A in human tumor cell lines

These approaches can be complemented with molecular dynamics simulations and structural analysis to identify critical interaction interfaces for targeted mutagenesis studies.

What assays can measure TMEM30A-dependent flippase activity?

Several methodological approaches can quantify the flippase activity of TMEM30A-containing complexes:

• NBD-labeled phospholipid translocation assays: Measuring the internalization of fluorescent phospholipid analogs

• Flow cytometry with annexin V: Detecting phosphatidylserine exposure on the outer leaflet

• ATP hydrolysis assays: Measuring ATPase activity with colorimetric or radioisotope methods

• Lipid mass spectrometry: Quantifying lipid distribution between membrane leaflets

• Fluorescence recovery after photobleaching (FRAP): Analyzing lipid mobility in membrane domains

When designing these experiments, it's important to include appropriate controls:

• TMEM30A knockout or knockdown conditions

• P4-ATPase inhibitors (such as orthovanadate)

• Catalytically inactive P4-ATPase mutants

• ATP-depleted conditions

How can TMEM30A be genetically manipulated for functional studies?

Several genetic approaches have proven effective for studying TMEM30A function:

• Conditional knockout models: As demonstrated in pancreatic β-cell-specific Tmem30a knockout mice, which develop metabolic disorders resembling diabetes

• CRISPR-Cas9 gene editing: For creating precise mutations or deletions in cell lines

• RNAi-mediated knockdown: Using siRNA or shRNA approaches to reduce TMEM30A expression

• Overexpression systems: As shown in hepatocellular carcinoma and cervical cancer cell lines

• Domain swapping/chimeric constructs: To identify functional regions between chicken and mammalian TMEM30A proteins

When manipulating TMEM30A expression, researchers should monitor:

• Effects on associated P4-ATPase expression and localization

• Compensatory upregulation of paralogs like TMEM30B

• Changes in phospholipid distribution across membrane leaflets

• Alterations in vesicular trafficking pathways

What disease models benefit from TMEM30A research?

Research on TMEM30A has implications for several disease models:

• Metabolic disorders: TMEM30A's role in insulin secretion and glucose sensing makes it relevant for diabetes research

• Cancer progression: TMEM30A's involvement in cell migration pathways and association with cancer biomarkers (ATP11A) suggests applications in oncology research

• Neurological disorders: The ATP8A2-TMEM30A complex influences neurite outgrowth, suggesting relevance to neurodegeneration models

• Cholestasis and liver disorders: TMEM30A mutations have been associated with intrahepatic cholestasis

• Immune dysregulation: Through its role in phosphatidylserine externalization during apoptosis and immune cell recognition

When studying these disease models, researchers should consider:

• Tissue-specific expression patterns of TMEM30A

• Differential interactions with P4-ATPase family members across tissues

• Compensatory mechanisms that may mask phenotypes in acute studies

How does TMEM30A contribute to signaling networks in tumor migration?

TMEM30A regulates several signaling networks involved in tumor migration:

• A computational biology approach identified a complex signaling network regulated by TMEM30A during tumor migration, constructed from:

  • STRING database interactions

  • Mass spectrometry results of the TMEM30A complex

  • Literature-derived migration-related genes

• TMEM30A overexpression in cancer cell lines demonstrated regulation of migration-related genes, with significant impacts on:

  • Cytoskeletal reorganization pathways

  • Membrane ruffle formation

  • Cell adhesion molecule expression

  • Matrix metalloproteinase activity

The biosystems approach combining computational prediction with experimental validation provides a framework for understanding how TMEM30A influences the molecular machinery of cell migration in tumor progression.

What are critical quality control parameters for recombinant chicken TMEM30A?

When working with recombinant chicken TMEM30A, researchers should verify:

• Purity assessment: SDS-PAGE analysis should demonstrate >90% purity

• Western blot confirmation: Using antibodies against both the protein and any fusion tags

• Mass spectrometry validation: To confirm protein identity and detect post-translational modifications

• Secondary structure analysis: Circular dichroism to confirm proper folding

• Glycosylation status: Particularly for proteins expressed in eukaryotic systems

• Stability testing: Temperature and pH dependence studies

• Functionality assessment: Ability to interact with P4-ATPases and support flippase activity

For chicken TMEM30A expressed in E. coli, special attention should be paid to refolding procedures if the protein is expressed in inclusion bodies, as proper membrane protein folding is critical for function.

How can researchers analyze TMEM30A membrane topology?

Several methodological approaches can characterize TMEM30A membrane topology:

• Protease protection assays: Using proteases with membrane-intact vesicles to determine exposed regions

• Fluorescence microscopy with GFP fusions: Tagging different domains to determine orientation

• Surface biotinylation: To identify extracellular exposed domains

• Glycosylation mapping: Analyzing N-glycosylation sites, which occur in extracellular/luminal domains

• Cysteine accessibility methods: Using membrane-impermeable thiol-reactive reagents

• Epitope insertion: Adding epitope tags at various positions for antibody accessibility studies

These approaches can validate computational predictions about TMEM30A's two transmembrane domains and extracellular loop containing three cysteine residues and N-glycosylation sites .

What considerations are important when designing site-directed mutagenesis of TMEM30A?

When planning site-directed mutagenesis of chicken TMEM30A, researchers should consider:

• Target selection based on conservation: Focus on residues conserved between chicken and human TMEM30A

• Functional domain targeting:

  • Transmembrane domains (implicated in P4-ATPase interaction)

  • Extracellular loop (particularly the conserved cysteines)

  • N-glycosylation sites

  • P4-ATPase binding interfaces

• Mutation type selection:

  • Conservative substitutions to maintain structural integrity

  • Charge-altering mutations to disrupt electrostatic interactions

  • Cysteine mutations to disrupt potential disulfide bonds

  • Glycosylation site mutations to assess processing requirements

• Controls and validation:

  • Expression level verification

  • Subcellular localization analysis

  • P4-ATPase interaction assays

  • Flippase activity measurements

Mutations that disrupt interactions with P4-ATPases without affecting protein stability are particularly valuable for dissecting the mechanistic role of TMEM30A in flippase complex formation and function.