Recombinant Chicken Cholinephosphotransferase 1 (CHPT1)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Enzymatic Properties

CHPT1 plays a crucial role in the CDP-choline pathway (Kennedy pathway), which is responsible for de novo synthesis of phosphatidylcholine (PC), a major constituent of cellular membranes. The enzyme catalyzes the final step of this pathway by transferring phosphocholine from CDP-choline to 1,2-diacyl-sn-glycerol (DAG), resulting in the formation of PC and the release of CMP .

Unlike the related enzyme choline/ethanolamine phosphotransferase 1 (CEPT1), which can utilize both CDP-choline and CDP-ethanolamine as substrates to synthesize PC and phosphatidylethanolamine (PE) respectively, CHPT1 exclusively utilizes CDP-choline as a donor substrate . This substrate specificity is an important distinguishing feature of CHPT1 and highlights its specialized role in PC biosynthesis.

The enzymatic activity of CHPT1 is dependent on optimal buffer conditions, including appropriate pH, divalent cations, and substrate concentrations. While specific kinetic parameters for chicken CHPT1 have not been extensively characterized in the available literature, studies on mammalian CHPT1 indicate that it has distinct substrate preferences and enzymatic properties compared to CEPT1 .

Subcellular Localization and Comparative Analysis with CEPT1

A significant aspect of CHPT1 biology is its distinct subcellular localization. Immunohistochemical analyses have revealed that mammalian CHPT1 (also referred to as CPT1 in some literature) localizes to the trans-Golgi network, whereas the related enzyme CEPT1 is predominantly found in the endoplasmic reticulum (ER) . This differential localization suggests that these enzymes synthesize choline phospholipids at different subcellular sites, potentially contributing to the spatial organization of specific lipid species within cellular membranes.

Table 2: Comparative Analysis of CHPT1 and CEPT1

FeatureCHPT1 (CPT1)CEPT1
Subcellular LocalizationTrans-Golgi networkEndoplasmic reticulum
Substrate SpecificityCDP-choline onlyBoth CDP-choline and CDP-ethanolamine
ProductsPC onlyPC and PE
Relative ActivityLower specific activityHigher specific activity for PC synthesis
Tissue Expression (Mammals)Highest in testis, colon, small intestine, heart, prostate, and spleenUniversally expressed in mammalian organs
Lipid Species PreferenceHigher preference for 1-alkyl-2-acyl-PC with PUFALower preference for 1-alkyl-2-acyl-PC with PUFA

Physiological Roles and Implications in Lipid Metabolism

The physiological importance of CHPT1 in phospholipid metabolism extends beyond basic PC synthesis. Recent research suggests that CHPT1 and CEPT1 may have differential contributions to the regulation of lipid homeostasis and cellular functions . For instance, while CEPT1 knockout has been shown to affect the regulation of CTP:phosphocholine cytidylyltransferase (CCTα, the rate-limiting enzyme in PC synthesis) and lipid droplet biogenesis, CHPT1 knockout does not appear to have similar effects .

The distinct subcellular localization of CHPT1 in the Golgi apparatus suggests it may play a specialized role in providing PC for specific cellular processes, particularly those involving the Golgi secretory pathway. The phospholipids synthesized by CHPT1 may have unique properties or distributions that serve specific functions in cellular membranes or organelles.

Research using knockout models has revealed that disruption of choline phosphotransferase activities can lead to alterations in the levels of specific phospholipid molecular species, indicating that these enzymes contribute to the diversity and specificity of the cellular lipidome .

Applications of Recombinant Chicken CHPT1 in Research

Recombinant Chicken CHPT1 serves as a valuable tool for various research applications in the field of lipid biochemistry and cell biology. Some key applications include:

  1. Enzymatic Assays: Purified recombinant CHPT1 can be used in in vitro assays to study the kinetics and substrate specificity of the enzyme, providing insights into the mechanisms of PC biosynthesis.

  2. Structural Studies: The availability of purified recombinant protein facilitates structural analyses through techniques such as X-ray crystallography or cryo-electron microscopy, which can elucidate the molecular mechanisms underlying CHPT1's catalytic function.

  3. Antibody Production: Recombinant CHPT1 can serve as an antigen for generating specific antibodies, which are useful for immunolocalization studies, Western blotting, and immunoprecipitation experiments.

  4. Protein-Protein Interaction Studies: The recombinant protein can be employed in pull-down assays or co-immunoprecipitation experiments to identify interaction partners of CHPT1, providing insights into its regulation and cellular functions.

  5. Inhibitor Screening: Recombinant CHPT1 can be utilized in high-throughput screening assays to identify potential inhibitors or modulators of its activity, which may have applications in pharmacological research.

Production Considerations and Quality Control

The production of Recombinant Chicken CHPT1 requires careful consideration of several factors to ensure the functionality and purity of the final product. As noted in commercial product specifications, the protein is typically expressed in mammalian cells to facilitate proper folding and potential post-translational modifications . The production process may involve custom specifications to meet specific research needs, with typical lead times between 5-9 weeks .

Quality control measures for Recombinant Chicken CHPT1 include:

  1. Purity Assessment: SDS-PAGE analysis to confirm protein purity exceeding 80% .

  2. Endotoxin Testing: LAL method to ensure endotoxin levels below 1.0 EU per μg of protein .

  3. Functional Verification: Enzymatic activity assays to confirm that the recombinant protein retains its catalytic function.

  4. Storage Stability: Evaluation of protein stability under various storage conditions to establish appropriate handling recommendations.

Proper storage of the recombinant protein is crucial for maintaining its activity. Short-term storage at +4°C and long-term storage at -20°C to -80°C are recommended, with avoidance of repeated freeze-thaw cycles to preserve protein integrity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please specify your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize development of the specified tag.
Synonyms
CHPT1; RCJMB04_34i2; Cholinephosphotransferase 1; Diacylglycerol cholinephosphotransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
CHPT1
Target Protein Sequence
MAAPWVLPAPLSPAQLKRLEQHRYSSAGRSLLEPWLQPYWGWLVERLPPWLAPNAITLGG LLLNCLTALPLIASCPTATEQAPFWAYILGALGLFIYQSLDAIDGKQARRTNSSSPLGEL FDHGCDSISTVFVVLGSCIAIRLGTNPDWLFFCCFVGLFMFYSAHWQTYVSGILRFGKVD VTEVQIAITMLLLVSAFCGTAVWDYKVHLVGLELKFFAVVGILCGTAVSCFNYFRIIFGG GVGKNGSTIAVAHMTKSEISLQDTAFIGPGLLFLDQYFNSFIDEYVVLWIALFISLFDML RYATGVCLQIAAHLHIHVFRISSHQAPEQVQNHND
Uniprot No.

Target Background

Function
Cholinephosphotransferase 1 (CHPT1) catalyzes the biosynthesis of phosphatidylcholine from CDP-choline, playing a pivotal role in the formation and maintenance of vesicular membranes.
Database Links
Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Chicken CHPT1 and what is its primary function?

Chicken Cholinephosphotransferase 1 (CHPT1) is an essential enzyme involved in phospholipid metabolism, specifically in the final step of the de novo synthesis of phosphatidylcholine (PC) via the Kennedy pathway. CHPT1 catalyzes the transfer of phosphocholine from cytidine diphosphate-choline (CDP-choline) to diacylglycerol (DAG), producing PC and cytidine monophosphate (CMP) . This reaction requires Mg²⁺ as a cofactor for catalytic activity . PC synthesis is critical as it is the most abundant phospholipid in eukaryotic cell membranes and serves as a precursor to various other phospholipids and second messengers, including phosphatidylserine, sphingomyelin, phosphatidic acid, and lyso-PC .

What is the genomic and protein information for Chicken CHPT1?

Chicken CHPT1 is officially designated as "choline phosphotransferase 1" in Gallus gallus (chicken) with the gene ID 418098 . The protein reference sequence is NP_001025935, and it is cataloged in UniProt with the ID Q5ZHQ5 . Based on structural studies of related CHPT1 proteins, the enzyme likely forms a homodimer, with each protomer containing 10 transmembrane helices (TMs) . The first 6 TMs typically create a cone-shaped enclosure in the membrane where catalysis occurs, with the enclosure opening to the cytosolic side where CDP-choline and Mg²⁺ are coordinated .

What expression systems are commonly used for producing recombinant chicken CHPT1?

Recombinant chicken CHPT1 can be produced using various expression systems, with mammalian cell expression being one of the most common approaches for maintaining proper protein folding and post-translational modifications . Commercial preparations of recombinant chicken CHPT1 are typically expressed in mammalian cells and purified with affinity tags such as His-tags to facilitate isolation . Alternative expression systems include bacterial systems like E. coli, though these may require codon optimization for efficient expression of eukaryotic proteins . When selecting an expression system for chicken CHPT1, researchers should consider factors such as required post-translational modifications, protein solubility, and the intended experimental applications. For structural studies or enzymatic assays, higher purity preparations (>80%) are recommended to minimize interference from contaminants .

What methodologies are most effective for assessing chicken CHPT1 enzymatic activity in vitro?

Effective assessment of chicken CHPT1 enzymatic activity requires careful consideration of reaction conditions and substrate preparation. A recommended protocol involves:

  • Substrate preparation: Use radiolabeled CDP-choline (typically ¹⁴C or ³H labeled) and purified DAG substrates in the presence of Mg²⁺ (typically 5-10 mM) .

  • Reaction conditions: Optimize buffer conditions (typically pH 7.4-8.0) with appropriate detergents to solubilize the membrane-associated enzyme without disrupting its activity. Common detergents include CHAPS or Triton X-100 at concentrations below their critical micelle concentration .

  • Assay procedure: Incubate purified recombinant chicken CHPT1 (50-200 ng) with substrates at 37°C for 15-30 minutes. Terminate the reaction with organic solvents (chloroform:methanol mixture) to extract lipids.

  • Analysis: Separate reaction products using thin-layer chromatography and quantify radiolabeled PC formation using scintillation counting or phosphorimaging.

  • Controls: Include negative controls (heat-inactivated enzyme) and positive controls (commercially available CHPT1 with known activity) to validate assay performance.

For kinetic analyses, vary substrate concentrations to determine Km and Vmax values. The presence of 5-10 mM Mg²⁺ is critical as it coordinates with CDP-choline and is essential for catalytic activity .

How can researchers investigate the relationship between CHPT1 activity and hepatic steatosis in chicken models?

Investigating the relationship between CHPT1 activity and hepatic steatosis in chickens requires a multi-faceted approach:

  • Expression analysis: Quantify CHPT1 gene expression in liver tissues from normal and steatotic chickens using RT-qPCR. Research has shown that CHPT1 expression is significantly higher (2.57-fold) in healthy controls compared to chickens with hepatic steatosis .

  • Protein analysis: Assess CHPT1 protein levels using Western blotting with specific antibodies against chicken CHPT1. Correlate protein levels with enzymatic activity measurements.

  • Metabolomic profiling: Analyze PC content and composition in liver tissues, as reduced PC production leads to impaired VLDL synthesis and TG export, contributing to steatosis .

  • Integrated pathway analysis: Examine related genes in the PC synthesis pathway (PEMT, CHKA, PCYT1A) alongside CHPT1, as these have been found to be coordinately downregulated in steatotic conditions .

  • Intervention studies: Design gain/loss-of-function experiments using overexpression or siRNA-mediated knockdown of CHPT1 in chicken hepatocytes to establish causality in the steatosis phenotype.

This comprehensive approach will help establish whether CHPT1 downregulation is a cause or consequence of hepatic steatosis and identify potential intervention points for treating or preventing this condition in poultry .

What structural considerations are important when designing inhibitors or modulators of chicken CHPT1?

Designing effective inhibitors or modulators of chicken CHPT1 requires careful consideration of its structural features:

  • Transmembrane topology: Target the cone-shaped catalytic enclosure formed by the first 6 transmembrane helices, which is accessible from the cytosolic side .

  • Substrate binding pockets: Design compounds that mimic or compete with either CDP-choline or DAG binding. The CDP-choline binding site coordinates with Mg²⁺ ions, so targeting this interaction could be effective .

  • Conserved vs. variable regions: Focus on chicken-specific regions that differ from mammalian CHPT1 to achieve species selectivity, while targeting conserved catalytic residues for general inhibition.

  • Dimerization interface: Consider compounds that could disrupt homodimerization, as CHPT1 functions as a homodimer .

  • Transmembrane entry points for DAG: Target the proposed entryway for DAG substrate, which may represent a unique regulatory point .

Computer-aided drug design approaches should incorporate homology models based on the Xenopus laevis CHPT1 structure, adjusted for chicken-specific sequence variations. Virtual screening can identify potential scaffold compounds, followed by structure-activity relationship studies to optimize potency and selectivity for chicken CHPT1 over related enzymes like CEPT1 or mammalian CHPT1 orthologs.

What are the optimal conditions for storing and handling recombinant chicken CHPT1 to maintain enzymatic activity?

Maintaining the enzymatic activity of recombinant chicken CHPT1 requires careful attention to storage and handling conditions:

Storage ParameterRecommended ConditionNotes
Short-term storage+4°CSuitable for 1-2 weeks with appropriate buffer
Long-term storage-20°C to -80°CPreferably at -80°C for extended stability
Buffer compositionPBS with glycerol (20-25%)Glycerol prevents freeze-thaw damage
pH7.2-7.4Maintain physiological pH
Additives1-5 mM DTT or β-mercaptoethanolProtects cysteine residues from oxidation
AliquotingSmall single-use aliquotsMinimizes freeze-thaw cycles
Thawing procedureRapid thawing at room temperatureFollowed by immediate transfer to ice

When handling the enzyme:

  • Avoid repeated freeze-thaw cycles, as membrane proteins are particularly susceptible to denaturation.

  • Include protease inhibitors in working solutions to prevent degradation.

  • When diluting, use buffers containing 0.1-0.5% non-ionic detergents (Triton X-100 or NP-40) to maintain solubility of this membrane-associated enzyme.

  • Validate activity after each significant storage period using standardized activity assays.

  • For maximum stability during experiments, maintain the enzyme on ice and prepare fresh working dilutions as needed .

What expression and purification strategies yield the highest activity for recombinant chicken CHPT1?

Achieving high activity in recombinant chicken CHPT1 preparations requires optimized expression and purification strategies:

  • Expression system selection: Mammalian expression systems (particularly HEK293 or CHO cells) provide the most natively folded chicken CHPT1 with proper post-translational modifications . For higher yields with potentially lower activity, insect cell systems (Sf9 or Hi5) using baculovirus vectors can be considered.

  • Construct design:

    • Incorporate a cleavable N-terminal signal peptide to ensure proper membrane insertion

    • Add a C-terminal affinity tag (His-tag is most common) with a flexible linker to minimize interference with protein folding

    • Consider including a fluorescent protein fusion for tracking expression and localization

  • Expression conditions:

    • For mammalian cells: Culture at 37°C until transfection, then reduce to
      30-32°C during expression to improve folding

    • Optimize induction time and harvesting point based on expression kinetics

    • Use additives like sodium butyrate (5-10 mM) to enhance expression

  • Membrane preparation and solubilization:

    • Carefully isolate membrane fractions using ultracentrifugation

    • Solubilize using mild detergents (DDM, LMNG, or CHAPS) at concentrations just above their critical micelle concentration

    • Include cholesterol or PC lipids during solubilization to stabilize the protein

  • Purification strategy:

    • Initial affinity chromatography (IMAC for His-tagged constructs)

    • SEC (size exclusion chromatography) to isolate properly folded dimeric species

    • Consider lipid nanodisc or amphipol reconstitution for enhanced stability

This approach typically yields preparations with >80% purity and good enzymatic activity . Throughout the process, avoid harsh detergents, extreme pH conditions, and excessive concentration steps that could compromise the structural integrity of this multi-pass membrane protein.

How can researchers effectively design binding studies to understand substrate specificity of chicken CHPT1?

Designing effective binding studies for chicken CHPT1 substrate specificity requires multiple complementary approaches:

  • Direct binding assays using purified components:

    • Utilize fluorescently labeled CDP-choline analogs to measure binding constants through fluorescence polarization

    • Employ isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding for both CDP-choline and DAG substrates

    • Implement surface plasmon resonance (SPR) with immobilized CHPT1 to measure real-time binding kinetics

  • Competition-based approaches:

    • Develop a panel of CDP-choline analogs with modifications to the cytidine, phosphate, or choline moieties

    • Utilize a series of structurally diverse DAG species with varying acyl chain lengths and saturation

    • Determine IC₅₀ values through competition with radiolabeled substrates

  • Functional enzyme assays with substrate variants:

    • Measure enzyme kinetics (Km, Vmax) with different substrate variants

    • Calculate specificity constants (kcat/Km) to quantitatively compare substrate preferences

    • Analyze the impact of Mg²⁺ concentration on substrate binding and catalysis

  • Structural studies to support binding mechanisms:

    • Utilize site-directed mutagenesis of predicted binding site residues based on homology models from Xenopus CHPT1

    • Employ hydrogen-deuterium exchange mass spectrometry to identify substrate-interacting regions

    • Consider computational docking studies to predict binding modes for various substrates

When interpreting results, researchers should remember that CHPT1 is a membrane protein with substrates that have varying solubility properties. Therefore, assay conditions, particularly detergent composition and concentration, must be carefully optimized to maintain native-like substrate binding properties while ensuring adequate solubility of both the enzyme and hydrophobic substrates like DAG.

What are the key considerations for developing and validating antibodies against chicken CHPT1?

Developing and validating antibodies against chicken CHPT1 requires careful planning and rigorous validation due to the membrane-embedded nature of the protein:

  • Antigen design strategies:

    • Target extracellular loops or cytoplasmic domains based on topology predictions

    • Use recombinant fragments of chicken CHPT1 rather than the full-length protein

    • Consider synthetic peptides from unique, accessible regions that differ from mammalian CHPT1

    • Ensure antigens are properly folded or at least contain native-like secondary structure

  • Antibody production approaches:

    • Monoclonal antibodies offer better specificity and reproducibility for research applications

    • Polyclonal antibodies may provide better sensitivity for detection of denatured protein

    • Consider chicken-specific antibody production to overcome poor immunogenicity in mammals

  • Essential validation criteria:

    • Western blotting against recombinant chicken CHPT1 with appropriate controls

    • Immunofluorescence staining to verify subcellular localization in chicken cells

    • Immunoprecipitation to confirm recognition of native protein

    • Knockout/knockdown validation to confirm signal specificity

    • Cross-reactivity testing against related proteins (especially CEPT1)

  • Common challenges and solutions:

    • Limited accessibility of transmembrane regions requires careful epitope selection

    • Low expression levels may necessitate signal amplification techniques

    • Detergent compatibility issues can be addressed by optimizing solubilization conditions

    • Variability between antibody lots requires standardized validation for each new lot

Researchers should document and report all validation steps performed, following the antibody validation guidelines established by scientific journals and organizations . For critical applications, using multiple antibodies targeting different epitopes can provide more reliable results and control for potential artifacts.

How does CHPT1 expression and function change in chicken models of fatty liver disease?

In chicken models of hepatic steatosis, CHPT1 expression and function undergo significant alterations that contribute to lipid accumulation pathology:

  • Expression patterns: CHPT1 gene expression is substantially downregulated in steatotic chicken livers compared to healthy controls, with approximately 2.57-fold lower expression . This reduction occurs alongside downregulation of other key genes in the PC synthesis pathway, including PEMT, CHKA, and PCYT1A .

  • Functional consequences: The reduced CHPT1 expression leads to decreased PC production, which impairs very-low-density lipoprotein (VLDL) synthesis and secretion . Since VLDL is essential for triglyceride export from hepatocytes, this impairment results in triglyceride accumulation within the liver, manifesting as steatosis .

  • Regulatory mechanisms: The coordinated downregulation of multiple PC synthesis genes suggests a common regulatory mechanism. This may involve transcription factors responsive to metabolic signals or microRNAs that target multiple genes in this pathway simultaneously.

  • Relationship to APOB: The observed reduction in CHPT1 expression coincides with dramatically decreased expression of APOB (13.4 times lower in severe steatosis compared to controls), the primary apolipoprotein for VLDL synthesis . This correlation suggests a potential regulatory link between PC synthesis and VLDL assembly pathways.

  • Metabolic compensation: Despite reduced CHPT1 activity, alternative pathways for PC synthesis (such as the PEMT pathway that converts phosphatidylethanolamine to PC) may show compensatory changes, though these mechanisms appear insufficient to prevent steatosis development.

These findings from chicken models provide valuable insights for understanding human non-alcoholic fatty liver disease, as the underlying mechanisms of lipid accumulation show significant conservation across species despite some metabolic differences between avian and mammalian hepatic function .

What comparative genomic insights can be gained from studying chicken CHPT1 versus mammalian orthologs?

Comparative genomic analysis of chicken CHPT1 and its mammalian orthologs reveals important evolutionary and functional insights:

  • Sequence conservation and divergence:

    • Chicken CHPT1 shares moderate sequence identity with mammalian orthologs, reflecting evolutionary divergence between avian and mammalian lineages

    • Critical catalytic residues and substrate binding domains show higher conservation, indicating functional constraints

    • The transmembrane topology appears conserved, suggesting similar membrane integration and organization across species

  • Structural implications:

    • The 10-transmembrane helix structure observed in Xenopus CHPT1 is likely preserved in chicken and mammalian orthologs

    • The internal pseudo two-fold symmetry between TM3-6 and TM7-10 represents an ancient gene duplication event that preceded the avian-mammalian split

    • Species-specific variations in certain loops and transmembrane regions may contribute to differences in substrate preferences or regulatory mechanisms

  • Regulatory elements:

    • Promoter analysis reveals both conserved and lineage-specific transcription factor binding sites

    • Avian-specific regulatory elements may reflect adaptations to the unique metabolic demands of egg-laying species

    • Alternative splicing patterns differ between chickens and mammals, potentially leading to functionally distinct isoforms

  • Metabolic context:

    • Chicken liver has unusually high capacity for de novo lipogenesis compared to mammals

    • CHPT1's role in PC synthesis may be particularly critical in avian species due to the high phospholipid requirements for egg production

    • Comparative pathway analysis reveals species-specific integration of CHPT1 activity with other metabolic processes

These comparative insights highlight how evolutionary conservation of core enzymatic functions can coexist with species-specific adaptations in regulatory mechanisms and metabolic integration. Understanding these differences is crucial for translating findings between avian models and mammalian systems, particularly when investigating lipid metabolism disorders or developing targeted therapeutics .

How can recombinant chicken CHPT1 be utilized in developing models for phospholipid metabolism disorders?

Recombinant chicken CHPT1 offers valuable opportunities for developing models of phospholipid metabolism disorders with applications in both veterinary and comparative medicine:

  • Cell-based model systems:

    • Overexpression studies: Transfect chicken hepatocyte cell lines with wild-type or mutant CHPT1 constructs to study gain-of-function effects

    • Knockdown/knockout models: Use RNAi or CRISPR-Cas9 to reduce or eliminate CHPT1 expression in chicken hepatocytes

    • Reporter systems: Develop dual-reporter assays that couple CHPT1 activity to fluorescent or luminescent outputs for high-throughput screening

  • In vitro pathway reconstitution:

    • Establish liposome-based systems incorporating purified recombinant chicken CHPT1 to reconstitute PC synthesis

    • Create artificial membrane systems to study CHPT1 activity under controlled lipid composition conditions

    • Develop coupled enzyme assays linking CHPT1 activity to VLDL assembly for mechanistic studies

  • Applications in understanding specific disorders:

    • Hepatic steatosis: Model how CHPT1 downregulation leads to impaired PC synthesis and subsequent triglyceride accumulation

    • Membrane integrity disorders: Investigate how altered PC composition affects membrane properties and cellular function

    • Lipoprotein metabolism: Explore the relationship between CHPT1 activity, PC availability, and VLDL assembly/secretion

  • Comparative studies with clinical relevance:

    • Compare chicken and human CHPT1 responses to potential therapeutic compounds

    • Identify conserved regulatory mechanisms that could be targeted across species

    • Develop parallel models in chicken and mammalian systems to distinguish fundamental versus species-specific aspects of phospholipid metabolism disorders

These approaches leverage the experimental advantages of the chicken system, including accessibility of tissues, well-characterized genetics, and metabolic similarities to humans in certain aspects of lipid metabolism. The combined use of recombinant protein and cellular/organismal models can provide comprehensive insights into how CHPT1 dysfunction contributes to phospholipid metabolism disorders across species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.