Recombinant Chicken Cleft lip and palate transmembrane protein 1-like protein (CLPTM1L)

Shipped with Ice Packs
In Stock

Description

Introduction to Chicken CLPTM1L

CLPTM1L (Cleft Lip and Palate Transmembrane Protein 1-Like) is a transmembrane protein that has gained significant research interest due to its diverse biological roles. In chickens (Gallus gallus), the CLPTM1L gene is located on chromosome 11 and encodes a protein with important cellular functions . The recombinant form of this protein has been developed to facilitate detailed research into its properties and biological activities.

The protein's name derives from its structural similarity to Cleft Lip and Palate Transmembrane Protein 1, though it represents a distinct protein with unique functions. In chickens, studies of CLPTM1L provide valuable insights into conserved biological mechanisms that may have parallels in other species, including humans. The recombinant form of Chicken CLPTM1L allows researchers to investigate its properties in controlled laboratory settings, advancing our understanding of its role in normal cellular processes and potential contributions to pathological conditions.

Recent research has established connections between CLPTM1L and various cellular activities, particularly in membrane dynamics and cellular survival pathways. These functions make this protein particularly relevant for investigations into developmental processes, cellular stress responses, and disease mechanisms. The development of recombinant Chicken CLPTM1L provides researchers with a valuable tool to explore these mechanisms in greater detail.

Historical Context and Discovery

The study of CLPTM1L emerged partly through investigations into developmental anomalies in chickens, particularly the cleft primary palate (cpp) mutation, which causes severe upper beak truncation in affected embryos . While the cpp mutation itself has been linked to a frameshift mutation in the ESRP2 gene, these developmental studies have contributed to broader interest in proteins involved in craniofacial development, including CLPTM1L. The chicken model has proven valuable for studying such developmental processes due to its accessibility during embryonic stages and relatively short generation time .

Subsequent research has expanded our understanding of CLPTM1L beyond developmental contexts. In particular, studies in human cell lines have identified CLPTM1L as a protein that may confer resistance to certain chemotherapeutic agents, suggesting its potential role in cellular survival mechanisms . This finding has sparked increased interest in the protein's functions across different species, including its recombinant form derived from chicken.

Physical and Biochemical Properties

The recombinant protein features specific characteristics optimized for research applications. These specifications are summarized in the following table:

ParameterSpecification
SourceMammalian Cells
TagHis
FormLiquid or lyophilized powder
Endotoxin< 1.0 eu per μg
Purity>80%
Storage BufferPBS buffer
Storage Conditions (Short-term)+4°C
Storage Conditions (Long-term)-20°C to -80°C

The protein is typically supplied with a histidine tag to facilitate purification and detection in experimental settings . The expression in mammalian cells helps ensure that the protein maintains structural features similar to the native form. The endotoxin level is kept below 1.0 eu per μg of protein, as determined by the LAL method, ensuring the recombinant protein is suitable for sensitive cellular assays without interference from bacterial contaminants .

Production and Manufacturing Considerations

Recombinant Chicken CLPTM1L production typically requires custom manufacturing with lead times between 5-9 weeks . This extended production period reflects the complexity of expressing mammalian transmembrane proteins in cell culture systems while maintaining proper folding and functionality. The protein can be provided in either liquid form or as a lyophilized powder, with the latter offering advantages for long-term storage and stability.

Quality control measures typically include verification of protein identity, assessment of purity (>80%), and testing for endotoxin contamination . These measures ensure that the recombinant protein is suitable for a wide range of research applications, from biochemical characterization to cellular assays.

Genetic Characteristics of Chicken CLPTM1L

The chicken CLPTM1L gene provides important context for understanding the recombinant protein's structure and function. Genetic analysis reveals specific features that may contribute to the protein's biological activities.

Gene Structure and Organization

The CLPTM1L gene in chickens (Gallus gallus) is identified by Gene ID 420973, with the protein product referenced as NP_001012882 in the RefSeq database and Q5ZKJ0 in UniProt . The gene is located on chromosome 11, in a region that has been studied in relation to developmental mutations.

Recent analyses have identified regions of variable number tandem repeats (VNTRs) within the CLPTM1L gene, including multiple sites designated as MS1, MS2, MS3, and MS4 . These variable regions may contribute to genetic diversity and potentially influence gene expression or protein function. The MS2 region in particular has been studied for its potential regulatory effects on CLPTM1L expression .

Evolutionary Conservation

While specific information on the evolutionary conservation of chicken CLPTM1L is limited in the provided search results, comparative studies between species suggest that CLPTM1L maintains conserved functions across vertebrates. The human homolog has been extensively studied, particularly in the context of cancer biology, suggesting that fundamental aspects of CLPTM1L function may be conserved between species .

This conservation makes the chicken CLPTM1L an important model for understanding basic biological processes that may be relevant across species, including humans. The recombinant chicken protein therefore offers potential insights into conserved mechanisms of cellular physiology and pathology.

Functional Roles of CLPTM1L

Research into CLPTM1L has revealed several important functional roles, primarily established through studies of the human homolog but likely applicable to the chicken protein as well, given evolutionary conservation of core cellular processes.

Membrane Transport Function

A critical function of CLPTM1L appears to be its role as a scramblase that mediates the translocation of specific lipids across cellular membranes. Specifically, CLPTM1L has been shown to facilitate the movement of glucosaminylphosphatidylinositol (GlcN-PI) from the cytosolic leaflet to the luminal leaflet of the endoplasmic reticulum (ER) membrane . This translocation is an essential step in the biosynthesis of glycosylphosphatidylinositol (GPI), a lipid glycoconjugate involved in post-translational modification of proteins .

In addition to GlcN-PI, CLPTM1L can also translocate other phospholipids, including phosphatidylinositol (PI), phosphatidylcholine, phosphatidylethanolamine, and N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI) . This broad substrate specificity suggests a versatile role in membrane lipid organization and trafficking, which may have implications for various cellular processes dependent on membrane composition and dynamics.

Role in Cellular Survival and Apoptosis

Studies of CLPTM1L in human cancer cells have revealed an important role in regulating cellular responses to genotoxic stress. CLPTM1L appears to protect cells from apoptosis induced by chemotherapeutic agents such as cisplatin and camptothecin . This protective effect operates through regulation of Bcl-xL, an anti-apoptotic protein that inhibits mitochondrial membrane permeabilization and subsequent cell death .

When CLPTM1L expression is reduced through knockdown approaches, cancer cells show increased sensitivity to apoptotic stimuli, in direct proportion to the level of CLPTM1L reduction . Conversely, overexpression of CLPTM1L is associated with resistance to apoptosis, potentially contributing to cancer cell survival and resistance to therapy . While these studies were conducted using human CLPTM1L, the conserved nature of apoptotic pathways across species suggests that chicken CLPTM1L may have similar functions.

CLPTM1L in Disease Models

The study of CLPTM1L has particular relevance to disease models, especially in the context of developmental abnormalities and cancer biology.

Developmental Abnormalities

In chickens, developmental studies have examined mutations affecting craniofacial development, including the cleft primary palate (cpp) mutation. While this specific mutation has been linked to a frameshift in the ESRP2 gene rather than CLPTM1L directly, these investigations have contributed to broader understanding of proteins involved in facial development . The cpp mutation results in a severely truncated upper beak and is inherited in an autosomal recessive pattern .

The name of CLPTM1L (Cleft Lip and Palate Transmembrane Protein 1-Like) suggests a potential relationship with developmental processes affecting craniofacial structures, although direct evidence for CLPTM1L's role in chicken facial development is not explicitly established in the available research results.

Cancer Biology and Therapeutic Resistance

In human cancer research, CLPTM1L has emerged as a significant factor in tumor biology. The gene is located in a chromosomal region that frequently shows copy number gain in early stages of non-small cell lung cancer (NSCLC), and multiple genome-wide association studies have linked this locus to lung cancer risk in both smokers and non-smokers .

Expression analyses have found CLPTM1L to be elevated in lung adenocarcinomas compared to matched normal lung tissues, suggesting a potential role in tumorigenesis . Functionally, CLPTM1L appears to contribute to cancer cell survival by protecting against apoptosis induced by genotoxic stress, including chemotherapeutic agents . This protective effect operates through regulation of Bcl-xL, with CLPTM1L knockdown leading to decreased Bcl-xL levels and increased sensitivity to apoptotic stimuli .

While these cancer-related findings derive from studies of human CLPTM1L, they suggest potential research directions for investigating chicken CLPTM1L in avian cancer models or comparative oncology studies.

Research Applications of Recombinant Chicken CLPTM1L

Recombinant Chicken CLPTM1L offers numerous potential applications in biological and biomedical research.

Antibody Development and Validation

Recombinant Chicken CLPTM1L can serve as an immunogen or standard for antibody development and validation. Antibodies against CLPTM1L enable various research applications, including:

  1. Immunohistochemical analysis of tissue expression patterns

  2. Western blotting for protein expression analysis

  3. Immunoprecipitation for protein complex studies

  4. Flow cytometry for cellular analyses

The availability of well-characterized antibodies significantly expands the toolkit for investigating CLPTM1L's biological roles in various contexts .

Comparative Biology and Evolution

Chicken CLPTM1L provides valuable opportunities for comparative studies across species. By comparing the structure, function, and regulation of CLPTM1L between chickens and other vertebrates, researchers can gain insights into:

  1. Evolutionary conservation of lipid transport mechanisms

  2. Species-specific adaptations in membrane biology

  3. Divergent or conserved roles in developmental processes

  4. Comparative aspects of disease mechanisms

These comparative approaches contribute to broader understanding of fundamental biological processes that transcend individual species.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CLPTM1L; RCJMB04_10g15; Cleft lip and palate transmembrane protein 1-like protein; CLPTM1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-536
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
CLPTM1L
Target Protein Sequence
MLSRSSFTSLAVGVFAVYVAHTCWVMYGIVYTRPCPSGGAAACVWPYLARRPKLQLSVYT TTRSNIGAESNIDLVLNVEDFDIESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWH DGKQVHIVSPLTTYMVPKPEEINLLTGESTTQQIEAEKQTSALDEPVSHWRSRLTLNVMV EDFVFDGSSLPADVHRYMKMVQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVS YDKISLGKLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLF DFLAFKNDISFWKKKRSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLIPAGIGAVIE LWKVKKALKMTVKWQGIRPKVQFGASNDSEKKTEEYDTQAMKYLSYLLYPLCIGGAAYSL LNVKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKMKSVAHLPWKAFTYKAFNTFIDD IFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKSRVNEYGESYEEKPKKKSS
Uniprot No.

Target Background

Function
Overexpression of this protein may enhance cisplatin-mediated apoptosis.
Database Links
Protein Families
CLPTM1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of chicken CLPTM1L protein?

Chicken CLPTM1L is a transmembrane protein with multiple predicted transmembrane domains. The protein consists of 536 amino acids and shares approximately 93% homology with mammalian CLPTM1L . The full amino acid sequence is: mLSRSSFTSLAVGVFAVYVAHTCWVMYGIVYTRPCPSGGAAACVWPYLARRPKLQLSVYTTTRSNIGAESNIDLVLNVEDFDIESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHIVSPLTTYMVPKPEEINLLTGESTTQQIEAEKQTSALDEPVSHWRSRLTLNVMVEDFVFDGSSLPADVHRYMKMVQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVSYDKISLGKLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLFDFLAFKNDISFWKKKRSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLIPAGIGAVIELWKVKKALKMTVKWQGIRPKVQFGASNDSEKKTEEYDTQAMKYLSYLLYPLCIGGAAYSLLNVKYKSWYSWLINSFVNGVYAFGFLFmLPQLFVNYKMKSVAHLPWKAFTYKAFNTFIDDIFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKSRVNEYGESYEEKPKKKSS .

What are the predicted cellular functions of chicken CLPTM1L?

Chicken CLPTM1L functions as a membrane scramblase that mediates the translocation of various phospholipids, including glucosaminylphosphatidylinositol (GlcN-PI), phosphatidylinositol (PI), phosphatidylcholine, and phosphatidylethanolamine across the endoplasmic reticulum (ER) membrane . This activity is crucial for the biosynthesis of glycosylphosphatidylinositol (GPI), a lipid glycoconjugate involved in post-translational protein modification . Additionally, genomic analyses have implicated chicken CLPTM1L in apoptotic processes related to environmental adaptation .

How is CLPTM1L expressed in chicken tissues?

CLPTM1L is expressed across various chicken tissues. Genomic analyses of the Niya chicken breed, native to the Taklimakan Desert region, have identified CLPTM1L as one of the genes involved in adaptation to hot arid and harsh environments . The expression patterns may vary across different tissues and under various environmental conditions, with current evidence suggesting its involvement in stress response pathways .

What expression systems are optimal for producing recombinant chicken CLPTM1L?

For recombinant chicken CLPTM1L production, several expression systems have been utilized:

  • Mammalian cell expression systems: These are preferred for chicken CLPTM1L expression as they provide appropriate post-translational modifications and proper protein folding .

  • Wheat germ cell-free expression systems: An alternative approach when studying protein structure and initial functional characterization, though may lack some post-translational modifications .

The choice of expression system should be determined by the specific research requirements:

  • For structural studies: Mammalian cell systems with His-tags for purification are recommended

  • For functional assays: Expression systems that maintain native protein conformation are crucial

What purification strategies are effective for recombinant chicken CLPTM1L?

Effective purification of recombinant chicken CLPTM1L typically involves:

  • Affinity chromatography: Using His-tag affinity purification for His-tagged CLPTM1L variants

  • Buffer optimization: PBS buffer is commonly used for storage

  • Quality control: SDS-PAGE and Western blotting to verify protein integrity and purity (>80% purity is generally achievable)

For transmembrane proteins like CLPTM1L, inclusion of appropriate detergents during purification is critical to maintain protein solubility while preserving native conformation.

How does CLPTM1L contribute to chicken adaptation to environmental stressors?

Genomic analyses have identified CLPTM1L as part of a selective region associated with adaptation to hot arid and harsh environments in chickens, particularly in the Niya chicken breed native to the Taklimakan Desert . CLPTM1L appears to function in apoptotic pathways, which may play roles in:

  • Cellular response to thermal stress and drought conditions

  • Regulation of cell survival under harsh environmental conditions

  • Modulation of stress response pathways

The adaptive role of CLPTM1L likely involves its interaction with other genes that collectively contribute to complex genetic mechanisms enabling native chickens to thrive in challenging environments .

What protein interactions are important for chicken CLPTM1L function?

Based on studies of human CLPTM1L, which shares high homology with chicken CLPTM1L, important protein interactions include:

  • Non-muscle myosin II (NMM-II): In human studies, CLPTM1L interacts with NMM-II, affecting cell shape, migration, and cytokinesis . This interaction may be conserved in chicken CLPTM1L.

  • Potential interactions with other proteins: Analysis using the String database suggests possible interactions with proteins including TERT, SLC6A18, LPCAT1, and ATF7IP .

For experimental validation of chicken CLPTM1L interactions, co-immunoprecipitation followed by mass spectrometry would be an appropriate methodology, similar to approaches used in human CLPTM1L studies .

How does chicken CLPTM1L localize within cells?

Based on immunofluorescence studies of human CLPTM1L, which is homologous to chicken CLPTM1L, the protein primarily localizes to:

  • The endoplasmic reticulum (ER) membrane, consistent with its role in phospholipid translocation

  • The perinuclear cytoplasm, with particularly dense distribution in this region

For chicken CLPTM1L, subcellular localization can be determined using immunofluorescence with cross-reactive antibodies or epitope-tagged recombinant protein. Colocalization studies with ER markers would help confirm the predicted localization pattern.

How can knockout/knockdown models be used to study chicken CLPTM1L function?

To investigate chicken CLPTM1L function, several approaches are available:

  • siRNA-mediated knockdown:

    • Transfect chicken cell lines with CLPTM1L-specific siRNAs

    • Confirm knockdown efficiency via RT-qPCR and Western blotting

    • Assess phenotypic changes in cellular processes including proliferation, apoptosis, and stress response

  • CRISPR-Cas9 genome editing:

    • Design guide RNAs targeting chicken CLPTM1L gene

    • Generate knockout chicken cell lines or embryos

    • Analyze effects on cellular function and development

  • Conditional knockout models:

    • Generate tissue-specific or inducible CLPTM1L knockout models to avoid potential embryonic lethality

    • Study tissue-specific functions of CLPTM1L

When designing these experiments, consider analyzing changes in gene expression profiles, cellular morphology, and response to environmental stressors like heat shock or oxidative stress.

How can differential expression analysis of chicken CLPTM1L inform functional studies?

Differential expression analysis of chicken CLPTM1L can guide functional studies by:

  • Identifying condition-specific regulation:

    • Compare CLPTM1L expression across different environmental conditions (heat stress, drought, etc.)

    • Analyze expression in different chicken breeds adapted to varying environments

    • Examine temporal expression patterns during development

  • Correlation with phenotypic traits:

    • Correlate CLPTM1L expression levels with specific adaptations or phenotypes

    • Identify potential regulatory relationships with other genes

  • Pathway analysis:

    • In human studies, CLPTM1L-related genes are enriched in pathways involving protein processing in the endoplasmic reticulum, protein folding, ER formation, N-glycan biosynthesis, and protein hydroxylation

    • Similar analyses in chicken tissues could reveal conserved or divergent functional pathways

These approaches would provide insights into the regulatory networks and biological processes involving chicken CLPTM1L.

How conserved is CLPTM1L structure and function across species?

CLPTM1L shows remarkable conservation across vertebrate species:

  • Sequence homology:

    • Chicken CLPTM1L shares approximately 93% similarity with human CLPTM1L

    • High conservation suggests fundamental biological importance

  • Structural conservation:

    • Transmembrane topology appears conserved across species

    • Key functional domains, including those involved in phospholipid scramblase activity, are preserved

  • Functional conservation:

    • Core functions in ER membrane phospholipid translocation and GPI biosynthesis are likely conserved

    • Species-specific adaptations may exist, particularly in stress response pathways

This high conservation facilitates cross-species extrapolation of functional data but also emphasizes the need to identify species-specific aspects of CLPTM1L biology.

What genetic variations in chicken CLPTM1L have been identified across breeds?

Genomic analyses have identified variations in CLPTM1L among chicken breeds:

  • The Niya chicken breed, native to the Taklimakan Desert region, shows selective signatures in the CLPTM1L gene region compared to chicken breeds from humid and temperate areas

  • These genetic variations may contribute to the adaptation of Niya chickens to hot arid and harsh environments

Further research comparing CLPTM1L sequences across diverse chicken breeds could reveal additional variants and their potential functional implications.

How can chicken CLPTM1L research inform understanding of human CLPTM1L function?

Chicken CLPTM1L research offers valuable comparative insights for human studies:

  • Evolutionary conservation:

    • The high sequence similarity (93%) between chicken and human CLPTM1L enables comparative functional studies

    • Conserved functions likely represent fundamental biological roles

  • Adaptive significance:

    • Studies of CLPTM1L in environmentally-adapted chicken breeds may reveal stress-response functions relevant to human health

    • Environmental adaptation mechanisms could inform therapeutic approaches

  • Disease relevance:

    • Human CLPTM1L is implicated in cancer progression and cisplatin resistance

    • Chicken models could provide insights into conserved mechanisms of CLPTM1L involvement in disease

Comparative approaches studying CLPTM1L across species offer powerful tools for distinguishing core conserved functions from species-specific adaptations.

What are the current technical challenges in chicken CLPTM1L research?

Several challenges currently limit comprehensive research on chicken CLPTM1L:

  • Limited availability of chicken-specific reagents:

    • Few antibodies specifically validated for chicken CLPTM1L

    • Need for development and validation of chicken-specific tools

  • Membrane protein expression and purification:

    • CLPTM1L's multiple transmembrane domains present challenges for expression and purification

    • Maintaining native conformation during purification requires careful optimization

  • Functional assay development:

    • Limited established assays for measuring chicken CLPTM1L scramblase activity

    • Need for development of chicken-specific functional assays

Addressing these challenges requires collaborative efforts between experts in protein biochemistry, avian biology, and molecular genetics.

What novel approaches could advance understanding of chicken CLPTM1L function?

Several innovative approaches could propel chicken CLPTM1L research forward:

  • Cryo-EM structural analysis:

    • Determine the 3D structure of chicken CLPTM1L to understand its membrane topology and functional domains

    • Compare with human CLPTM1L structure to identify conserved and divergent features

  • Single-cell transcriptomics:

    • Analyze cell-specific expression patterns of CLPTM1L in chicken tissues

    • Identify co-expressed genes that may function in common pathways

  • High-throughput phospholipid translocation assays:

    • Develop assays to measure scramblase activity of recombinant chicken CLPTM1L

    • Screen for modulators of CLPTM1L activity

  • In ovo gene editing:

    • Use CRISPR-Cas9 to modify CLPTM1L in developing chicken embryos

    • Assess developmental and physiological consequences

These approaches would provide comprehensive insights into chicken CLPTM1L biology.

How might chicken CLPTM1L research contribute to agricultural applications?

Research on chicken CLPTM1L has potential applications in poultry science and agriculture:

  • Breed improvement:

    • Identifying beneficial CLPTM1L variants associated with stress tolerance

    • Potential for marker-assisted selection for enhanced environmental adaptation

  • Heat stress resistance:

    • Understanding CLPTM1L's role in adaptation to hot environments could inform strategies to improve heat tolerance in commercial chicken breeds

    • Particularly relevant as climate change increases heat stress challenges in poultry production

  • Disease resistance:

    • If CLPTM1L is involved in immune or stress response pathways, findings could contribute to breeding programs for disease-resistant chickens

These applications align with increasing demands for sustainable and climate-resilient poultry production systems worldwide .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.