Recombinant Chicken Corticotropin-releasing factor receptor 1 (CRHR1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Chicken CRHR1 is a 48.6 kDa G protein-coupled receptor (GPCR) encoded by the CRHR1 gene (UniProt: Q90812) with seven transmembrane domains . Key structural features include:

PropertyDetail
Molecular Weight48,600 Da
SubunitsInteracts with CRH/UCN ligands
Cell Membrane LocationMulti-pass membrane protein
Binding AffinityHigh affinity for CRH and urocortin

The recombinant form preserves native conformational properties required for ligand binding studies, particularly in HEK293 expression systems .

Functional Role in Avian Physiology

CRHR1 mediates critical biological processes:

  • Stress Response Activation: Ligand binding triggers adenylate cyclase activation, increasing intracellular cAMP levels .

  • HPA Axis Regulation: Facilitates ACTH secretion from the pituitary gland during stress .

  • Signal Transduction: Engages Gαs-protein coupling, initiating downstream PKA and CREB phosphorylation cascades .

"CRHR1-induced CREB activity is responsible for increased REST expression at the transcriptional level, modulating neural stem cell properties during embryogenesis."

Experimental Tools

  • ELISA Kits: Commercial kits (e.g., MBS7228236) detect native CRHR1 in serum, plasma, and tissue homogenates with ≤10% intra-assay CV .

  • Protein Interaction Studies: Used to map CRH/urocortin binding domains using co-immunoprecipitation assays .

Key Findings from Avian Studies

Study FocusOutcomeSource
CRHBP InteractionsCRHBP inhibits CRHR1-mediated ACTH release in chickens
Embryonic DevelopmentCRHR1 knockdown reduces REST expression, impairing neural stem cell maintenance

Regulatory Pathways

CRHR1 operates through two primary mechanisms:

  1. cAMP-PKA-CREB Cascade:

    • CRH binding → Gαs activation → adenylate cyclase stimulation → cAMP elevation → PKA/CREB phosphorylation .

  2. REST Transcription Regulation:

    • CRHR1 signaling upregulates REST, a transcriptional repressor maintaining neural stem cell quiescence .

Challenges and Future Directions

Current limitations include the lack of publicly available crystal structures for avian CRHR1 isoforms. Future studies could leverage recombinant chicken CRHR1 to:

  • Investigate epigenetic regulation of stress adaptation in poultry

  • Develop CRHR1 antagonists for agricultural stress management .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
CRHR1; Corticotropin-releasing factor receptor 1; CRF-R-1; CRF-R1; CRFR-1; Corticotropin-releasing hormone receptor 1; CRH-R-1; CRH-R1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-420
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
SIQEQYCESLLPTTNHTGPQCNASVDLIGTCWPRSAVGQLVARPCPEYFYGVRYNTTNNG YRECLANGSWAARVNYSQCQEILSEEKRSKLHYHIAVIINYLGHCVSLGTLLVAFVLFMR LRSIRCLRNIIHWNLITAFILRNATWFVVQLTMNPEVHESNVVWCRLVTAAYNYFHVTNF FWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKR AGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLSLL GITYMLFFVNPGEDEISRIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRKRWHRWQD KHSIRARVARAMSIPTSPTRVSFHSIKQSSAV
Uniprot No.

Target Background

Function
Corticotropin-releasing factor receptor 1 (CRHR1) is a G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). It exhibits high affinity for both CRH and UCN. Ligand binding induces a conformational change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and downstream effectors, such as adenylate cyclase. CRHR1 promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels.
Gene References Into Functions
  1. CRHR1 expression is primarily restricted to corticotropes, suggesting that CRH-induced adrenocorticotropin release is a direct consequence of corticotrope stimulation. In contrast, CRH-stimulated TSH release is not directly mediated by the known chicken CRHR1. PMID: 12782401
Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of chicken CRHR1?

Chicken CRHR1 (cCRHR1) is a G-protein coupled receptor that binds corticotropin-releasing hormone (CRH) and urocortin (UCN) with high affinity. The receptor consists of an N-terminal extracellular domain, seven transmembrane domains, and an intracellular C-terminal domain.

Functionally, cCRHR1 acts as a primary mediator in the stress response pathway. When activated by ligand binding, it undergoes a conformational change that triggers signaling via G proteins, primarily activating adenylate cyclase and increasing intracellular cAMP levels . The receptor also influences the PLC/IP3/Ca²⁺ and MEK/ERK signaling pathways .

Unlike mammalian CRHR1, which has higher affinity for CRH than CRHR2, chicken CRH has been shown to be equipotent in activating both receptor subtypes . This represents an important species-specific difference in CRH receptor pharmacology.

How is CRHR1 expressed in chicken tissues and how can this expression be quantified?

CRHR1 expression in chickens shows a distinctive tissue distribution pattern. Studies have demonstrated that cCRHR1 is abundantly expressed in:

  • Brain regions (particularly cerebrum and hypothalamus)

  • Pituitary gland

  • Ovary

  • Various peripheral tissues

For quantifying CRHR1 expression, several methodological approaches are recommended:

  • qPCR Analysis: Using specific primers targeting cCRHR1 mRNA. Example primers used in research include:

    • Forward primer: 5′-GGGCAGCCCGTGTGAATTATT-3′

    • Reverse primer: 5′-ATGACGGCAATGTGGTAGTGC-3′

  • RNA-seq Analysis: Transcript quantitative analysis tools such as Salmon v0.10.2 can be used to quantify gene expression levels from RNA-seq datasets. Expression is typically reported as transcripts per million (TPM) .

  • Immunocytochemistry (ICC): Using specific antibodies against cCRHR1, particularly those recognizing the N-terminus (which resides in the first extracellular domain) .

When conducting expression studies, it's important to validate results using multiple techniques, as discrepancies between mRNA and protein levels have been observed in some tissues.

What are the most effective methods for producing recombinant chicken CRHR1 protein for research purposes?

Production of high-quality recombinant cCRHR1 protein involves several critical steps and considerations:

  • Expression System Selection: For chicken CRHR1, both mammalian expression systems (e.g., HEK293 cells) and yeast expression systems have been successfully employed . The choice depends on research needs:

    • Mammalian systems provide appropriate post-translational modifications

    • Yeast systems typically yield higher protein quantities

  • Vector Design: Optimal vector design includes:

    • Codon optimization for the expression host

    • Addition of tags (e.g., His-tag) for purification

    • Including elements like WPRE to enhance expression

  • Protein Domain Selection: For functional studies, researchers often use:

    • The N-terminal extracellular domain (approximately amino acids 23-121 in human CRHR1)

    • Full-length protein for signaling studies

  • Purification Protocol:

    • Collect conditional medium after transfection (typically 24-48 hours)

    • Concentrate through ultrafiltration spin

    • Purify using affinity chromatography (e.g., nickel columns for His-tagged proteins)

  • Quality Control:

    • Verify purity via SDS-PAGE (aim for >90% purity)

    • Confirm identity through Western blotting

    • Test functionality through binding assays with known ligands (CRH, UCN)

Optimal storage conditions include maintaining the protein in a Tris-based buffer with 50% glycerol, avoiding repeated freeze-thaw cycles, and storing working aliquots at 4°C for short-term use or at -20°C/-80°C for longer storage .

How does the CRHR1 signaling pathway function in chickens and how does it differ from mammals?

The cCRHR1 signaling pathway involves several interconnected molecular cascades:

  • Primary Signaling Pathway:

    • Ligand binding (CRH or UCN) to cCRHR1

    • G protein activation (primarily Gαs)

    • Adenylate cyclase activation

    • Increased intracellular cAMP levels

    • Protein kinase A (PKA) activation

    • CREB phosphorylation and nuclear translocation

    • Target gene regulation

  • Secondary Pathways:

    • PLC/IP3/Ca²⁺ pathway activation

    • MEK/ERK signaling cascade stimulation

Key Species Differences:

ParameterChickensMammals
Ligand SelectivityCRH is equipotent at CRHR1 and CRHR2CRH has higher affinity for CRHR1 than CRHR2
Downstream TargetsIncludes TSHβ in addition to ACTHPrimarily regulates ACTH
Response to StressUpregulation of CRHBP (binding protein)Similar feedback regulation via CRHBP
Novel ModulatorsCRH2 peptide (absent in placental mammals)No CRH2 peptide present

In chickens, the unique presence of CRH2 and its preferential activation of CRHR2 over CRHR1 (15-fold higher potency) represents a significant species difference in the CRH signaling system .

How can researchers use genetic tools to study CRHR1 function in animal models?

Several genetic approaches have been developed to study CRHR1 function:

  • Transgenic Reporter Systems:

    • BAC transgenesis to create promoter-driven reporter lines (e.g., Crhr1-FlpO mouse)

    • FlpO or Cre recombinase expression under CRHR1 promoter control enables selective genetic access to CRHR1-expressing cells

  • Viral-Mediated Manipulation:

    • Flp-dependent adeno-associated viruses (AAVs) expressing fluorescent reporters

    • Viral constructs showing >90% co-localization with endogenous CRHR1

  • Intersectional Genetic Approaches:

    • Combining Cre-lox and Flp-FRT systems for cell-type-specific manipulations

    • Crossing Crhr1-FlpO mice with Flp-dependent reporter mice

  • Validation Techniques:

    • Immunocytochemistry using specific antibodies (e.g., goat anti-CRHR1 that recognizes N-terminus)

    • Confocal microscopy to visualize co-localization of CRHR1 and reporter molecules

    • Western blotting to confirm protein expression

For researchers new to these approaches, it's recommended to start with reporter lines and validation studies before proceeding to more complex manipulations like conditional knockouts or intersectional genetics.

What role does CRHR1 play in the chicken hypothalamic-pituitary-adrenal (HPA) axis response to stress?

CRHR1 serves as a critical mediator in the chicken HPA axis stress response:

  • Anatomical Distribution:

    • Expressed in multiple brain regions including hypothalamus

    • Abundant expression in anterior pituitary

    • Present in adrenal tissues

  • Functional Roles:

    • Mediates CRH-induced ACTH secretion from anterior pituitary cells

    • CRH2, another ligand in chickens, can also induce ACTH secretion at high concentrations (≥10 nM)

    • Influences TSHβ mRNA expression, suggesting involvement in the hypothalamus-pituitary-thyroid (HPT) axis

  • Stress Response Regulation:

    • Stress significantly upregulates CRHBP (CRH-binding protein) mRNA expression

    • CRHBP acts as a negative feedback regulator to modulate CRHR1 signaling

    • Glucocorticoids influence this regulatory system

  • Methodological Approach to Study HPA Function:

    • Culture of primary chicken pituitary cells

    • Treatment with CRH or CRH2 at various concentrations

    • Measurement of ACTH secretion via radioimmunoassay or ELISA

    • Quantification of downstream gene expression (e.g., TSHβ) via qPCR

This system represents an excellent model for comparative studies of HPA axis function across vertebrates.

How do the binding properties of chicken CRHR1 compare to those of other species, and what methods best characterize these differences?

Comparative analysis of CRHR1 binding properties reveals important evolutionary insights:

  • Ligand Preferences Across Species:

SpeciesCRH PreferenceUCN PreferenceCRH2 Preference
ChickenEquipotent at CRHR1/CRHR2Similar affinity for both15-fold preference for CRHR2 over CRHR1
MammalsHigher affinity for CRHR1Similar affinity for bothCRH2 absent in placental mammals
XenopusHigher affinity for CRHR1Data limitedPresent but less characterized
ZebrafishHigher affinity for CRHR1Data limitedAbsent (lost in teleosts)
  • Methodological Approaches for Binding Studies:

    a. Functional Assays:

    • Cell-based reporter systems measuring cAMP accumulation

    • PLC/IP3/Ca²⁺ pathway activation assessment

    • Luciferase reporter assays for CREB activation

    b. Binding Assays:

    • Radioligand binding with [¹²⁵I]-labeled ligands

    • Competition binding assays with unlabeled peptides

    • Surface plasmon resonance for binding kinetics

    c. Structural Analysis:

    • Homology modeling based on crystal structures

    • Identification of critical binding residues in the N-terminal domain

    • Mutagenesis studies to confirm binding determinants

  • Evolutionary Considerations:

    • CRH2 presence in birds, reptiles, and spotted gars but absence in placental mammals and teleosts suggests selective evolutionary pressure

    • The equipotency of CRH at chicken CRHR1/CRHR2 versus mammalian preference for CRHR1 suggests evolutionary divergence in receptor specificity

What are the challenges in measuring CRHR1 protein levels in chicken samples and how can they be overcome?

Researchers face several technical challenges when quantifying CRHR1 protein:

  • Antibody Specificity Issues:

    • Challenge: Limited availability of chicken-specific antibodies

    • Solution: Use carefully validated antibodies such as goat anti-CRHR1 (Everest Biotech, CAT# EB08035; RRID: AB_2260976) that recognize the N-terminus of CRHR1 (amino acids 107–117)

    • Validation: Confirm specificity via Western blot showing appropriate molecular weight bands and through ICC showing expected cellular distribution

  • Low Expression Levels:

    • Challenge: CRHR1 is often expressed at low levels in many tissues

    • Solution: Employ signal amplification methods such as tyramide signal amplification for ICC, or use sensitive ELISA kits specifically designed for chicken CRHR1

    • Methodological approach: Concentrate samples through ultrafiltration before analysis

  • Cross-Reactivity with CRHR2:

    • Challenge: CRHR1 and CRHR2 share ~68% amino acid identity

    • Solution: Target N-terminal domain which is more divergent between subtypes

    • Validation: Confirm antibody specificity using tissues known to express predominantly one receptor subtype

  • Sample Preparation Optimization:

    • For serum/plasma: Remove interfering proteins through specific pre-treatments

    • For tissue homogenates: Optimize extraction buffers to maintain receptor integrity

    • For cell culture: Consider analyzing both membrane fractions and total cell lysates

  • Quantification Standards:

    • Use recombinant chicken CRHR1 protein as a standard for calibration curves

    • Include appropriate positive and negative controls in each experiment

    • Evaluate linearity, recovery, and inter/intra-assay coefficients of variation

How does CRHR1 signaling influence neural development, and what methods can be used to study this process?

CRHR1 plays significant roles in neural development through several mechanisms:

  • CRHR1/CREB/REST Signaling Cascade:

    • CRHR1 activation leads to CREB phosphorylation

    • Activated CREB regulates REST (RE1-Silencing Transcription Factor) expression

    • REST controls neural differentiation by regulating neurogenesis-related genes

  • Regulation of Neurogenic Factors:

    • CRHR1 signaling influences expression of key neurogenic transcription factors:

      • NEUROG1 and NEUROG2 (neurogenin 1 and 2)

      • NEUROD2 (neurogenic differentiation factor 2)

      • NEX1 (neuronal helix-loop-helix protein)

  • Methodological Approaches for Developmental Studies:

    a. Gene Expression Analysis:

    b. Neural Progenitor Culture Systems:

    • Isolation and culture of neural progenitor cells

    • Viral transduction for genetic manipulation

    • Treatment with CRH or specific CRHR1 agonists/antagonists

    • Assessment of differentiation markers via ICC or flow cytometry

    c. Transgenic Approaches:

    • Crhr1-FlpO mouse models for cell-type-specific studies

    • Flp-dependent reporter expression in neural progenitors

    • Lineage tracing of CRHR1-expressing neural populations

  • Functional Significance:

    • CRHR1 signaling plays an important role downstream of CRH in regulating neural stem cells during embryonic brain development

    • This pathway represents a potential therapeutic target for developmental disorders

What genetic variations in CRHR1 influence stress responses and reward learning, and how can they be studied?

Genetic variations in CRHR1 can significantly impact stress responses and reward-related behaviors:

  • Key CRHR1 Genetic Variants:

    • rs12938031 has been associated with stress-induced reward learning abnormalities

    • Homozygosity for the A allele at rs12938031 may increase risk for psychopathology via these mechanisms

  • Neurophysiological Effects:

    • Acute stress is associated with blunted response bias in reward learning tasks

    • Smaller and delayed feedback-related positivity (FRP) in EEG recordings

    • Reduced anterior cingulate and orbitofrontal cortex activation to reward

  • Methodological Approaches:

    a. Genotyping Strategies:

    • PCR-based genotyping for specific SNPs

    • Use of the Single Nucleotide Polymorphism Spectral Decomposition (SNPSpD) program to adjust significance levels for multiple SNP comparisons

    • Application of Bonferroni correction that accounts for linkage disequilibrium between SNPs

    b. Behavioral Assessment:

    • Probabilistic reward learning tasks

    • Experimental design incorporating stress manipulation (e.g., threat of shock)

    • Measurement of response bias as a primary behavioral variable

    c. Neurophysiological Measures:

    • Event-related potentials (ERPs), particularly the feedback-related positivity (FRP)

    • EEG recording during reward tasks

    • Source localization to dorsal anterior cingulate cortex and striatal regions

  • Statistical Approaches:

    • ANOVA with genotype as a between-subjects factor

    • Adjustment of significance thresholds for multiple comparisons

    • Post-hoc tests evaluated at α < 0.05 for significant omnibus effects

  • Comparative Considerations:

    • While most genetic studies have focused on mammals, similar approaches could be applied to investigate potential CRHR1 variants in chickens

    • Cross-species comparisons could provide evolutionary insights into stress response mechanisms

How can researchers develop and validate CRHR1-targeting viral vectors for neuroscience applications?

Developing effective viral vectors for CRHR1 targeting requires rigorous design and validation:

  • Vector Design Considerations:

    a. Promoter Selection:

    • BAC-based approach using the entire Crhr1 genomic locus for high specificity

    • Analysis of promoter regions (e.g., -989/+170 region for CRH2)

    • Identification of critical regulatory elements (CREB and AP1 binding sites)

    b. Recombinase System Selection:

    • FlpO system for compatibility with existing Cre-lox models

    • Codon-optimization of recombinase genes for improved expression

    • Inclusion of enhancer elements like WPRE

  • Construction Protocol:

    • BAC transgenesis approach similar to Crfr1-cre mouse and CRF 1:Cre rat

    • Targeting designed to insert the gene encoding FlpO to replace the ATG at the Crhr1 start codon

    • Screening colonies for accurate insertion by PCR

  • Validation Methods:

    a. Direct Assessment:

    • Injection of Flp-dependent viruses expressing fluorescent reporters

    • Immunocytochemistry to co-localize CRHR1 and reporter molecules

    • Quantification of specificity (aim for >90% co-localization)

    b. Transgenic Reporter Crossing:

    • Cross with transgenic Flp-dependent reporter mouse

    • Compare reporter expression with endogenous CRHR1 distribution

    • Assess specificity across multiple brain regions

  • Optimization Strategies:

    • Titration of viral concentration to minimize off-target expression

    • Testing different serotypes for optimal transduction of target cells

    • Incorporation of cell-type-specific enhancers to improve specificity

  • Applications:

    • Selective manipulation of CRHR1-expressing cells

    • Intersectional genetic approaches when combined with Cre-lox system

    • Cell-specific optogenetic or chemogenetic control

What are the discrepancies in CRHR1 research between species, and how can researchers address these contradictions?

Several notable discrepancies exist in CRHR1 research across species, requiring careful methodological approaches:

  • Ligand Specificity Discrepancies:

    • Contradiction: CRH is equipotent at CRHR1/CRHR2 in chickens but has higher affinity for CRHR1 in mammals

    • Methodological solution: Direct comparative binding studies using identical assay conditions and recombinant receptors from different species

    • Critical controls: Use species-specific ligands and receptors in parallel experiments

  • Anatomical Distribution Variations:

    • Contradiction: Some studies report limited CRH2 expression (e.g., isthmic region in spotted gars) while others find widespread expression in chickens

    • Methodological approach: Employ multiple detection methods (qPCR, in situ hybridization, reporter systems) and standardize sensitivity thresholds

    • Validation strategy: Cross-reference findings with complementary techniques (e.g., RNAscope with protein detection)

  • Functional Outcome Differences:

    • Contradiction: CRHR1 activation may produce different downstream effects across species (e.g., TSHβ stimulation in chickens)

    • Research approach: Use homologous systems (species-matched ligands, receptors, and cell types) when making functional comparisons

    • Analytical consideration: Account for differences in receptor density, G-protein coupling efficiency, and downstream effector expression

  • Experimental Design Recommendations:

    • Include multiple species in parallel studies when possible

    • Create standardized assay conditions that minimize technical variables

    • Develop species-specific tools (antibodies, ligands, expression systems)

    • Report detailed methodological parameters to facilitate cross-study comparisons

  • Evolutionary Context:

    • Consider phylogenetic relationships when interpreting differences

    • Analyze sequence divergence in critical domains (e.g., ligand binding regions)

    • Incorporate evolutionary models to explain functional shifts between species

The identification of CRH2 in birds but not mammals represents a particularly intriguing example of evolutionary divergence that merits further comparative investigation .

What are the best practices for isolating and studying CRHR1-expressing cells from chicken tissues?

Isolation and characterization of CRHR1-expressing cells requires specialized techniques:

  • Tissue Preparation Protocols:

    • For brain tissue: Careful dissection of specific regions (hypothalamus, pituitary)

    • For peripheral tissues: Enzymatic digestion (collagenase/dispase) to create single-cell suspensions

    • Critical parameters: Maintain cold conditions and use protease inhibitors to preserve receptor integrity

  • Cell Isolation Strategies:

    a. Fluorescence-Activated Cell Sorting (FACS):

    • Use fluorescent-labeled antibodies against CRHR1

    • Alternative: Develop transgenic chicken models with fluorescent reporters under CRHR1 promoter control

    • Gating strategy: Include appropriate negative controls and viability markers

    b. Magnetic-Activated Cell Sorting (MACS):

    • Utilize biotinylated antibodies against CRHR1 with streptavidin-conjugated magnetic beads

    • Enrichment process: Multiple sorting rounds may improve purity

    c. Laser Capture Microdissection:

    • Immunostain tissue sections for CRHR1

    • Selectively capture positive cells for downstream analysis

    • Applications: Particularly useful for maintaining anatomical context

  • Characterization Methods:

    a. Single-Cell RNA Sequencing:

    • Isolate RNA from sorted CRHR1-positive cells

    • Generate libraries for next-generation sequencing

    • Bioinformatic analysis: Identify co-expressed genes and unique markers

    b. Functional Assays:

    • Measure cAMP accumulation in response to CRH/UCN

    • Calcium imaging to assess PLC/IP3/Ca²⁺ pathway activation

    • Real-time monitoring of cellular responses to various stimuli

  • Culture Systems for Isolated Cells:

    • Primary culture of sorted CRHR1-expressing cells

    • Optimization of media conditions to maintain receptor expression

    • Co-culture with supporting cell types if needed for physiological responses

  • Validation Standards:

    • Confirm CRHR1 expression post-isolation by qPCR and immunocytochemistry

    • Assess functional responses to known ligands (CRH, UCN, CRH2)

    • Benchmark against established cell lines expressing CRHR1

This methodological approach facilitates the study of CRHR1-expressing cells in their native context while enabling detailed molecular and functional characterization.

How can researchers optimize promoter activities for recombinant CRHR1 expression systems?

Optimizing promoter activities for recombinant CRHR1 expression requires systematic analysis of regulatory elements:

  • Promoter Region Analysis:

    • Identify core promoter elements through 5′-RACE PCR to determine transcriptional start sites

    • Analyze the 5′-flanking regions for potential regulatory elements

    • Example: For CRH2, the -989/+170 region contains strong promoter activities

  • Deletion Analysis Strategy:

    • Create a series of deletion constructs of the promoter region

    • Clone these constructs into reporter vectors (e.g., luciferase)

    • Transfect into relevant cell lines and measure reporter activity

    • Example findings: The -989/-519 and -112/+170 regions possess strong promoter activities for CRH2

  • Identification of Regulatory Elements:

    • Analyze promoter sequences for transcription factor binding sites

    • Common relevant factors include CREB and AP1

    • Verify binding through electrophoretic mobility shift assays (EMSA)

    • Confirm functionality through site-directed mutagenesis of binding sites

  • Optimization Tables for Different Expression Systems:

Expression SystemOptimal Promoter ElementsEnhancer ElementsSpecies Considerations
Mammalian CellsCMV, EF1αWPRE, intronsHuman/mouse promoters typically work well
Chicken CellsChicken β-actin, CRHR1 native promoterHS4 insulatorSpecies-matched promoters recommended
YeastGAL1, ADH1None typically requiredCodon optimization critical
BacterialT7, tacNot applicableLimited for GPCR expression
  • Silencer Identification:

    • Some regions may contain negative regulatory elements

    • Example: The -518/-113 region in CRH2 promoter appears to contain silencers

    • Experimentally identify these through reporter assays with and without putative silencer regions

  • Validation in Target Cell Types:

    • Test optimized promoter constructs in the cell types of interest

    • Consider tissue-specific or inducible promoters for specialized applications

    • Verify expression levels through qPCR and Western blotting

This systematic approach enables the development of optimized expression systems for recombinant CRHR1 production, facilitating both basic research and potential therapeutic applications.

What role does CRHR1 play in the chicken immune system and how can this be investigated?

While less extensively characterized than its neuroendocrine functions, CRHR1 has important roles in immune regulation:

  • Expression in Immune-Related Tissues:

    • CRHR1 is expressed in various peripheral tissues in chickens

    • Stress conditions can modulate CRHR1 expression in immune organs

    • The wide tissue distribution of cCRHR1 suggests diverse physiological roles beyond the HPA axis

  • Methodological Approaches for Immune Function Studies:

    a. In Vitro Systems:

    • Isolation of primary chicken immune cells (splenocytes, thymocytes)

    • Treatment with CRH, CRH2, or specific CRHR1 agonists/antagonists

    • Measurement of cytokine production, proliferation, and activation markers

    b. In Vivo Approaches:

    • Stress paradigms (restraint, social, etc.) to activate the HPA axis

    • Administration of CRHR1 antagonists to determine receptor-specific effects

    • Assessment of immune parameters in various tissues

    c. Molecular Techniques:

    • qPCR for CRHR1 and immune-related genes

    • Flow cytometry to identify CRHR1-expressing immune cell subpopulations

    • Cytokine ELISAs to measure immune response parameters

  • Experimental Design Considerations:

    • Include appropriate stress and non-stress conditions

    • Control for circadian variations in HPA axis activity

    • Account for sex differences in stress responses

  • Translation to Poultry Health:

    • Stress-induced immune dysregulation affects production parameters

    • CRHR1-mediated pathways represent potential intervention targets

    • Understanding species-specific mechanisms is crucial for effective applications

  • Comparative Aspects:

    • While direct evidence from chicken studies is limited, mammalian studies show CRHR1 expression on various immune cells

    • The presence of CRH2 in chickens (absent in mammals) may introduce unique aspects to immune regulation

This research direction has significant implications for understanding stress-immune interactions in poultry, with potential applications for improving production and welfare under commercial conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.