Recombinant Chicken Cyclic nucleotide-gated channel rod photoreceptor subunit alpha

Shipped with Ice Packs
In Stock

Description

Functional Insights from Research

  • Phototransduction Role: CNGA1 forms heterotetrameric channels (3α:1β stoichiometry) with β-subunits, enabling Ca²⁺/Na⁺ influx in rod photoreceptors during dark adaptation . Light reduces cGMP levels, closing channels and hyperpolarizing the cell .

  • Regulation by Phosphoinositides: Structural studies reveal that N- and C-terminal regions of CNGA3 (cone homolog) mediate phosphoinositide (PIP₂/PIP₃) regulation . Similar mechanisms likely apply to CNGA1 due to conserved domains .

  • Calmodulin Modulation: Endogenous calmodulin binds β-subunits, reducing cGMP sensitivity in a Ca²⁺-dependent manner .

Expression and Purification

The recombinant protein (Creative BioMart Cat. RFL25324GF) is expressed in E. coli and purified via affinity chromatography :

ParameterSpecification
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended for storage
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

Biochemical and Electrophysiological Properties

  • Ligand Sensitivity: Half-maximal activation (K₁/₂) occurs at ~10–20 µM cGMP, with cAMP being a weaker agonist .

  • Ion Permeability: Permeable to Na⁺, K⁺, and Ca²⁺ (P_Ca/P_Na ≈ 25:1) .

  • Modulators:

    • Inhibited by PIP₂ and PIP₃ via N-terminal arginines .

    • Enhanced cAMP efficacy upon PIP₃ binding in cone homologs .

Applications in Research

  • Antibody Development: Monoclonal antibodies (e.g., L36/12) target cytoplasmic C-termini for immunohistochemistry and Western blotting .

  • Channelopathies: Mutations in CNGA1 homologs are linked to retinal degeneration and achromatopsia .

  • Structural Studies: Cryo-EM analyses of CNG channels inform gating mechanisms and drug design .

Key Research Findings

  1. Heteromeric Assembly: Co-expression with β-subunits (e.g., CNGB1) recapitulates native channel properties, including Ca²⁺-dependent feedback .

  2. Phosphorylation: Casein kinase 2 phosphorylates β-subunits, though this does not alter cGMP sensitivity .

  3. Evolutionary Conservation: The pore domain and CNBD are highly conserved across vertebrates, underscoring functional importance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Cyclic nucleotide-gated channel rod photoreceptor subunit alpha; CNG channel 3; CNG-3; CNG3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-645
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Protein Sequence
MKVGVIETHHSHPIIPSVVVQDTSEDPGLIEKGENRFARQWYLPGAFAQYNINNNSNKDE EKKKKKEKKSKSENKKDGERQKNKEKKEKHKNKDKKKGKEEEKKKDIFIIDPAGNMYYNW LFCITMPVMYNWTMIIARACFDELQNDYLAVWFIVDYVSDVIYIADMFVRTRTGYLEQGL LVKEEQKLKEKYKSSLQFKLDFLSIIPTDLLYFKLGLNYPELRINRLLRVARMFEFFQRT ETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGADTWVYPNTSHPEFARLTRK YVYSLYWSTLTLTTIGETPPPVRDSEYFFVVVDFLVGVLIFATIVGNVGSMISNMNAARA EFQAKIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAIN VHLETLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVA DDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEY PDAKAMLEEKGKQILMKDGLLDIEVANLGSDPKDLEEKVAYMEGSMDRLQTKFARLLAEY DAAQQKLKKRLTQIEKILKPVMEQEFLDFEEADPPTDKPGVTKTE
Uniprot No.

Target Background

Function
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as a second messenger. This protein can be activated by cGMP, leading to the opening of the cation channel and subsequent depolarization of rod photoreceptors.
Database Links

KEGG: gga:396143

STRING: 9031.ENSGALP00000022830

UniGene: Gga.671

Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of cyclic nucleotide-gated channels in chicken photoreceptors?

Cyclic nucleotide-gated (CNG) channels in chicken photoreceptors are nonselective cation channels that form heterotetrameric complexes consisting of different subunit types. These channels are opened by the direct binding of cyclic nucleotides, specifically cAMP and cGMP . Although their activity shows very little voltage dependence, they belong to the superfamily of voltage-gated ion channels . In rod photoreceptors, the CNG channel helps regulate ion flow into the rod photoreceptor outer segment in response to light-induced alterations of intracellular cGMP levels . The alpha subunit is particularly crucial for channel function as it contains the primary cyclic nucleotide binding domain and forms the ion-conducting pore of the channel.

How do chicken CNG channels differ from mammalian counterparts?

Chicken CNG channels share fundamental functional similarities with mammalian CNG channels but exhibit several notable differences. Unlike the rod-dominated retinas of mammals, chicks are tetrachromatic with a more diverse cone population, including single cones expressing red, green, blue, or violet opsins, as well as double-cones that comprise approximately half of all photoreceptors . This diversity in photoreceptor types is reflected in the expression patterns and functional properties of CNG channels in the chicken retina. Additionally, while both utilize similar channel subunit architecture, some chicken CNG channel subunits may have distinctive amino acid sequences that affect their biophysical properties, including ligand sensitivity, ion selectivity, and modulation by calcium.

What expression systems are most effective for producing functional recombinant chicken CNG channel alpha subunits?

For co-expression studies examining subunit interactions, baculovirus expression systems using insect cells offer advantages in expressing multiple subunits simultaneously while maintaining proper folding and assembly. When selecting an expression system, researchers should consider:

  • The intended experimental application (structural analysis, binding studies, electrophysiology)

  • Required post-translational modifications

  • The need for proper membrane targeting and assembly with other subunits

  • Potential cytotoxicity of overexpressed channel proteins

How can researchers validate the proper folding and functionality of recombinant chicken CNG channel alpha subunits?

Validating proper folding and functionality of recombinant chicken CNG channel alpha subunits requires a multi-faceted approach:

  • Biochemical assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

    • Size-exclusion chromatography to ensure proper oligomerization state

    • Limited proteolysis to confirm structural integrity

  • Functional validation:

    • Patch-clamp electrophysiology to measure cyclic nucleotide-dependent channel activation

    • Fluorescence-based ion flux assays using calcium-sensitive dyes

    • Radioligand binding assays to confirm cyclic nucleotide binding properties

  • Structural confirmation:

    • Electron microscopy of reconstituted channels in liposomes

    • X-ray crystallography or cryo-EM of purified protein

    • FRET-based approaches to analyze conformational changes upon ligand binding

A critical control experiment involves comparing the dose-response relationship of cGMP activation between recombinant channels and native channels from chicken rod photoreceptors, ensuring the recombinant protein exhibits physiologically relevant properties.

How can the recombinant chicken CNG channel alpha subunit be used to study phototransduction mechanisms?

The recombinant chicken CNG channel alpha subunit serves as a powerful tool for dissecting the molecular mechanisms of phototransduction through several sophisticated approaches:

  • Structure-function analysis:

    • Site-directed mutagenesis of key residues involved in cyclic nucleotide binding, ion permeation, and gating

    • Chimeric constructs with mammalian CNG channels to identify regions responsible for species-specific functional properties

    • Cross-linking studies to map subunit interactions and conformational changes

  • Reconstitution systems:

    • Lipid bilayer reconstitution with purified channel proteins and other phototransduction components

    • Cell-free expression systems for rapid screening of channel variants

    • Nanodiscs incorporation for single-molecule studies

  • Real-time dynamics:

    • Fluorescence resonance energy transfer (FRET) sensors to monitor conformational changes in response to cyclic nucleotides

    • High-speed calcium imaging to track channel activation kinetics

    • Computational modeling of channel gating based on experimental data from recombinant channels

These approaches allow researchers to explore how the chicken CNG channel alpha subunit responds to various stimuli, including light-induced changes in cGMP levels, calcium feedback mechanisms, and modulation by regulatory proteins specific to avian visual systems .

What strategies can be employed to investigate the interaction between the CNG channel alpha subunit and other phototransduction proteins?

Investigating interactions between the CNG channel alpha subunit and other phototransduction proteins requires sophisticated biochemical and biophysical approaches:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation using antibodies against the CNG channel alpha subunit

    • Pull-down assays with the recombinant His-tagged alpha subunit as bait

    • Surface plasmon resonance (SPR) to measure binding kinetics and affinities

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of interactions

  • In situ proximity analysis:

    • Proximity ligation assays (PLA) in chicken retinal tissue sections

    • Fluorescence complementation assays in heterologous expression systems

    • FRET/BRET approaches with fluorescently tagged proteins

  • Functional impact assessment:

    • Patch-clamp recordings in the presence of putative interacting proteins

    • Single-channel analysis to detect modulation of gating properties

    • Calcium imaging to assess changes in channel function

A detailed interaction map can be constructed using recombinant domains of the channel to identify specific regions involved in binding to regulatory proteins such as calmodulin, phosphodiesterases, and cytoskeletal elements that collectively regulate channel function in the complex environment of the rod photoreceptor outer segment .

How do the properties of chicken CNG channel alpha subunits inform our understanding of visual adaptation across species?

The study of chicken CNG channel alpha subunits provides valuable insights into visual adaptation across species, particularly in comparing diurnal (day-active) versus nocturnal animals:

  • Sensitivity tuning:

    • Chicken CNG channels show distinct cyclic nucleotide sensitivity profiles compared to mammalian channels, reflecting adaptation to diurnal vision

    • Differences in calcium permeability may correlate with species-specific adaptation mechanisms

    • Ligand selectivity (cGMP versus cAMP) varies across species, potentially reflecting environmental adaptations

  • Evolutionary conservation analysis:

    • Comparison of key functional domains across species reveals conserved regions essential for channel function

    • Species-specific variations in regulatory domains suggest adaptive evolution

    • Correlation between channel properties and visual ecology (e.g., color vision capabilities, light intensity environments)

  • Functional implications:

    • Species differences in channel kinetics correlate with temporal resolution requirements

    • Variations in calcium handling mechanisms reflect diverse adaptation needs

    • Modulation by regulatory partners shows species-specific patterns

The tetrachromatic vision system of chickens, compared to the trichromatic system of primates and dichromatic system of many rodents, presents a unique opportunity to study how CNG channel properties have been evolutionarily tuned to support different visual capabilities .

What insights can be gained from studying the expression patterns of CNG channel subunits in the developing chicken retina?

Studying expression patterns of CNG channel subunits in developing chicken retina provides critical insights into visual system development:

  • Developmental regulation:

    • Temporal expression profiles reveal critical periods for photoreceptor maturation

    • Spatial expression patterns demonstrate the establishment of specialized photoreceptor types

    • Coordination of CNG channel expression with other phototransduction components

  • Cell type specification:

    • Single-cell RNA sequencing data from chicken retina reveals distinct photoreceptor subtypes with specific CNG channel expression profiles

    • Correlation between opsin expression and CNG channel subunit composition

    • Identification of transcriptional networks regulating channel expression

  • Functional maturation:

    • Electrophysiological properties of developing photoreceptors correlate with CNG channel expression

    • Visual function development can be mapped to CNG channel maturation

    • Sensitivity to environmental factors affecting CNG channel expression during development

Using techniques such as single-cell RNA sequencing and the eCHIKIN method (electroporation-based CRISPR-Cas9-mediated homology-directed insertion) allows for temporal and spatial mapping of CNG channel expression during retinal development, providing insights into how specialization of visual function emerges .

What are the major challenges in expressing and purifying functional recombinant chicken CNG channel alpha subunits?

Researchers face several significant challenges when expressing and purifying functional recombinant chicken CNG channel alpha subunits:

  • Expression yield limitations:

    • Membrane proteins like CNG channels often express poorly in heterologous systems

    • Cytotoxicity from overexpression can limit yields

    • Formation of inclusion bodies in bacterial systems requires refolding

    Solution approaches: Optimization of expression conditions (temperature, induction parameters), use of specialized expression strains, and fusion with solubility-enhancing tags like MBP or SUMO.

  • Protein stability issues:

    • CNG channels may denature during solubilization and purification

    • Multiple transmembrane domains create complex folding requirements

    • Maintaining the tetrameric assembly during purification

    Solution approaches: Screening different detergents for solubilization, addition of stabilizing ligands during purification, and use of nanodiscs or amphipols to maintain native-like membrane environment.

  • Functional assessment difficulties:

    • Ensuring proper folding and assembly of purified channels

    • Reconstitution into functional assay systems

    • Validation of ligand binding and channel activity

    Solution approaches: Development of robust functional assays (fluorescence-based, electrophysiological), comparison with native channels, and structural validation methods.

The recombinant chicken CNG channel alpha subunit protein with His-tag described in the search results represents a solution to some of these challenges, allowing for affinity purification while maintaining the full-length protein sequence (amino acids 1-645) .

How can researchers address heterogeneity issues when studying recombinant CNG channels?

Addressing heterogeneity in recombinant CNG channel preparations requires systematic quality control and specialized techniques:

  • Biochemical homogeneity:

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state distribution

    • Mass spectrometry to confirm protein integrity and identify proteolytic fragments

    • Analytical ultracentrifugation to characterize solution behavior

  • Conformational homogeneity:

    • Single-particle cryo-EM classification to identify distinct conformational states

    • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

    • Fluorescence spectroscopy to monitor ligand-induced conformational changes

  • Functional homogeneity:

    • Single-channel recordings to assess channel population properties

    • Ligand binding assays with purified protein to determine binding site occupancy

    • Fluorescence-based ion flux assays to characterize functional subpopulations

  • Expression system optimization:

    • Co-expression of auxiliary subunits to promote proper assembly

    • Use of inducible expression systems to control expression levels

    • Development of stable cell lines with consistent expression profiles

By implementing these approaches, researchers can better understand the inherent heterogeneity of CNG channels and design experiments that account for this complexity when interpreting functional and structural data.

How might gene editing approaches advance our understanding of CNG channel function in chicken retinal tissues?

Gene editing approaches offer transformative potential for advancing our understanding of CNG channel function in chicken retinal tissues:

  • CRISPR-Cas9 applications:

    • The eCHIKIN method described in the search results offers a powerful approach to tag endogenous CNG channel genes with fluorescent reporters or Cre recombinase

    • Generation of knock-in models to introduce mutations associated with visual disorders

    • Creation of conditional knockout systems to study developmental roles

  • Spatiotemporal control of expression:

    • Optogenetic regulation of CNG channel expression

    • Inducible systems to control timing of gene modification

    • Cell-type specific promoters to target modifications to specific retinal cell populations

  • Functional genomics approaches:

    • CRISPR screens to identify novel regulators of CNG channel function

    • Multiplexed editing to study subunit interactions

    • Base editing for precise modification of key residues without double-strand breaks

The eCHIKIN method demonstrated in the chick retina represents a particularly valuable approach, allowing insertion of reporters into genes identified as cell-type specific through single-cell RNA sequencing, thereby enabling visualization of cellular morphology without requiring germline manipulation .

What novel structural biology approaches might reveal new insights into the gating mechanisms of chicken CNG channels?

Advanced structural biology approaches offer exciting opportunities to reveal new insights into chicken CNG channel gating mechanisms:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis of purified channels in different conformational states

    • Visualization of the channel in complex with regulatory proteins

    • Time-resolved cryo-EM to capture intermediate states during gating

  • Integrative structural approaches:

    • Combining X-ray crystallography of soluble domains with cryo-EM of full-length channels

    • Molecular dynamics simulations based on structural data to model gating transitions

    • Cross-linking mass spectrometry to map dynamic interactions during channel activation

  • Emerging techniques:

    • Cryo-electron tomography of channels in native membrane environments

    • Microcrystal electron diffraction for structures of challenging domains

    • Solid-state NMR to characterize conformational dynamics in membrane-embedded channels

  • Structure-guided functional studies:

    • Design of conformation-specific antibodies or nanobodies as tools to stabilize specific states

    • Structure-based virtual screening for novel modulators

    • Rational design of cyclic nucleotide analogs with altered binding properties

The application of these advanced structural approaches to chicken CNG channels would complement existing functional data and potentially reveal species-specific adaptations in channel architecture that support the unique visual capabilities of avian species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.