Recombinant Chicken Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MANHSQLGFQDASSPIMEELVEFHDHALMVALAICSLVLYLLTLMLMEKLSSNTVDAQEV ELIWTILPAIVLVLLALPSLQILYMMDEIDEPDLTLKAIGHQWYWTYEYTDFKDLSFDSY MTPTTDLPLGHFRLLEVDHRIVIPMESPIRVIITADDVLHSWAVPALGVKTDAIPGRLNQ TSFITTRPGVFYGQCSEICGANHSYMPIVVESTPLKHFEAWSSLLSS
Uniprot No.

Target Background

Function

Recombinant Chicken Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This complex drives oxidative phosphorylation by facilitating the transfer of electrons from NADH and succinate to molecular oxygen. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes collaboratively generate an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, comprised of heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Gene References Into Functions
  1. Studies indicate that two cytochrome c oxidase protein subunits (CO-I and CO-II) are influenced by both learning-independent and learning-dependent factors. PMID: 21839805
  2. Research suggests that dietary and management strategies aimed at modulating tissue polyunsaturated fatty acid status may influence lipid metabolism and COX-2 expression in poultry. PMID: 22080018
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of chicken cytochrome c oxidase subunit II, and how does it compare to other vertebrates?

Chicken cytochrome c oxidase subunit II (COII) is a mitochondrial DNA-encoded protein that forms a critical component of the terminal enzyme in the respiratory chain. The protein exhibits 64-66% amino acid sequence homology and 68-70% nucleotide sequence homology when compared with four other vertebrate counterparts . The full-length cDNA contains an open reading frame of approximately 684 bp encoding 227 amino acids, with a predicted molecular mass of 26.2 kDa and a pI value of 6.37, as determined in similar insect COII studies .

Four peptide segments, each consisting of nine amino acids, demonstrate high conservation across multiple species. Particularly significant is the redox center formed by three highly conserved domains that include:

  • Two invariant cysteine residues for copper ion coordination

  • Two invariant histidine residues for copper ion coordination

  • Three strictly conserved glutamic acid or aspartic acid residues for cytochrome c binding

  • Highly conserved aromatic acid residues that facilitate electron transfer

These structural elements are essential for the protein's function in catalyzing electron transfer from cytochrome c to molecular oxygen in the respiratory chain.

What expression systems are most effective for producing recombinant chicken COII?

For recombinant expression of chicken COII, the bacterial expression system using E. coli provides an effective and well-established platform. The recommended methodology involves:

  • Cloning the full-length cDNA of chicken COII into an expression vector such as pET-32a

  • Transforming the construct into an E. coli expression strain such as Transetta (DE3)

  • Inducing protein expression using isopropyl β-d-thiogalactopyranoside (IPTG)

  • Purifying the recombinant protein using affinity chromatography with Ni²⁺-NTA agarose if a 6-His tag has been incorporated into the expression construct

This approach typically yields fusion proteins of approximately 44 kDa with concentrations of about 50 μg/mL in initial preparations . Alternative eukaryotic expression systems may be considered for studies requiring post-translational modifications, though bacterial expression remains the most efficient for basic structural and functional studies.

How can I verify the activity of recombinant chicken COII in vitro?

The enzymatic activity of recombinant chicken COII can be assessed through multiple complementary approaches:

  • Spectrophotometric analysis: UV-spectrophotometer measurements can track the oxidation of reduced cytochrome c, the natural substrate of COII. The rate of absorbance change at 550 nm corresponds to cytochrome c oxidation activity .

  • Infrared spectrometry: This technique can be used to monitor structural changes and cofactor interactions during substrate oxidation .

  • Oxygen consumption assays: Using an oxygen electrode to measure the rate of oxygen consumption when the enzyme is added to reduced cytochrome c in an appropriate buffer system.

  • Inhibitor studies: Examining the effects of known cytochrome c oxidase inhibitors on the recombinant protein's activity can confirm functional properties.

When performing these assays, it is critical to maintain appropriate pH (typically 7.0-7.4), temperature (37°C), and ionic strength conditions that mimic the physiological environment of the mitochondrial membrane.

How can chicken COII be used in phylogenetic and evolutionary studies?

Chicken COII serves as a valuable marker for phylogenetic and evolutionary studies due to its combination of conserved functional domains and variable regions. Research methodologies include:

  • Mitochondrial marker analysis: COII can be analyzed alongside other mitochondrial markers like cytochrome b (Cyt b) to establish evolutionary relationships and population divergence .

  • Haplotype diversity assessment: Sequencing COII across different chicken populations reveals haplotype patterns that reflect genetic diversity and evolutionary history. For example, studies have found significant variation in haplotype diversity (Hd) across different chicken populations, with some native populations showing Hd values as high as 92.70% .

  • Comparative sequence analysis: Multiple sequence alignment and phylogenetic tree construction using COII sequences can help resolve evolutionary relationships among avian species and identify the ancestral origins of domestic chicken populations.

  • Molecular clock applications: The relatively consistent mutation rate in COII can be used to estimate divergence times between chicken populations and related species.

The utility of COII in these studies stems from its essential role in cellular respiration, which creates evolutionary pressure to maintain functional domains while allowing some sequence variability in less critical regions.

What techniques can be used to analyze the interaction between chicken COII and other components of the respiratory chain?

Analyzing the interactions between chicken COII and other respiratory chain components requires sophisticated biochemical and biophysical approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to chicken COII to pull down interacting proteins, followed by mass spectrometry identification of binding partners.

  • Surface plasmon resonance (SPR): Quantitative measurement of binding kinetics between purified COII and potential interaction partners like cytochrome c.

  • Molecular docking simulations: Computational modeling of interactions between COII and other proteins or small molecules. For example, molecular docking has been used to identify a potential hydrogen bond (2.9 Å) between a sulfur atom in allyl isothiocyanate (AITC) and Leu-31 in similar COII proteins .

  • Site-directed mutagenesis: Systematically modifying conserved residues (such as the invariant Cys and His residues involved in copper coordination) to assess their importance in protein-protein interactions and enzymatic function .

  • Cryo-electron microscopy: Determining the structure of COII within the context of the complete cytochrome c oxidase complex to understand spatial arrangements and interaction interfaces.

These techniques can reveal critical insights into how COII functions within the larger respiratory complex and how specific amino acid residues contribute to protein interactions and electron transfer.

How does genetic diversity in chicken COII affect functional properties across different breeds?

The functional implications of genetic diversity in chicken COII across different breeds can be investigated through an integrated approach:

  • Population genetics analysis: Using population-level sequencing data to identify non-synonymous mutations in COII that differ between chicken breeds or populations. Studies have shown significant variation in genetic diversity, with some populations having multiple haplotypes (e.g., eight haplotypes in Aravali chicken populations) while others show minimal polymorphism .

  • Enzyme kinetics comparison: Expressing recombinant COII variants representing different haplotypes and comparing their enzyme kinetics parameters (Km, Vmax) using cytochrome c oxidation assays.

  • Thermal stability analysis: Assessing whether sequence variations affect the thermal stability of COII, which may reflect adaptations to different environmental conditions across chicken breeds.

  • Respiratory efficiency measurements: In cellular systems, measuring whether COII variants result in measurable differences in respiratory efficiency or ROS production.

  • Phenotypic correlation studies: Correlating specific COII haplotypes with phenotypic traits in different chicken breeds, particularly those related to metabolic performance and environmental adaptation.

PopulationNumber of COII HaplotypesHaplotype Diversity (%)Functional Implications
Aravali892.70Greater adaptive potential, possibly related to environmental conditions
Ankleshwar334.50More genetically homogeneous, possibly due to selection or population history

This table summarizes findings from genetic diversity studies using the COX I gene in native Indian chicken populations .

What are the critical factors in designing primers for chicken COII cloning and expression?

Primer design for chicken COII amplification requires careful consideration of several factors:

  • Sequence specificity: Primers should be designed based on conserved regions of the chicken COII gene to ensure specific amplification. Reference the complete chicken mitochondrial genome sequence for accurate primer placement.

  • Addition of restriction sites: Incorporate appropriate restriction enzyme sites at the 5' ends of primers to facilitate directional cloning into expression vectors, allowing for an additional 3-6 nucleotides at the extreme 5' end to ensure efficient enzyme digestion.

  • Codon optimization: When expressing in heterologous systems like E. coli, consider codon optimization to improve expression efficiency, especially for rare codons in the bacterial host.

  • Tag incorporation: Consider incorporating sequences for affinity tags (His-tag, GST, etc.) either N- or C-terminally, being mindful that C-terminal tags may be preferable as the N-terminus may contain important targeting or functional sequences.

  • PCR optimization: Use touchdown PCR or gradient PCR to determine optimal annealing temperatures, typically starting with temperatures around 53-55°C based on similar studies .

Example primer designs for a 100-150 bp fragment might follow this pattern:

  • Forward: 5'-CTTTATCGGCTTCACTGCT-3'

  • Reverse: 5'-CATGAAAGTCAGCCCGATT-3'

Reaction conditions typically involve initial denaturation at 94°C for 5 min, followed by 30 cycles of 94°C for 10 s, 53°C for 10 s, and 72°C for 20 s, with a final extension at 72°C for 10 min .

What are the major challenges in purifying recombinant chicken COII, and how can they be addressed?

Purification of recombinant chicken COII presents several challenges that can be addressed through specific methodological approaches:

  • Inclusion body formation: COII often forms inclusion bodies when overexpressed in bacterial systems.

    • Solution: Use lower induction temperatures (16-20°C), reduce IPTG concentration, or co-express with molecular chaperones like GroEL/GroES.

  • Maintaining protein stability: As a membrane-associated protein, COII can be unstable in solution.

    • Solution: Include stabilizing agents such as glycerol (10-20%) and reducing agents like DTT or β-mercaptoethanol in all buffers.

  • Purification efficiency: Achieving high purity while maintaining activity can be challenging.

    • Solution: Implement a two-step purification process, beginning with affinity chromatography using Ni²⁺-NTA agarose for His-tagged proteins, followed by size exclusion chromatography to remove aggregates and impurities .

  • Protein yield optimization: Typical yields of approximately 50 μg/mL may be insufficient for extensive biochemical studies.

    • Solution: Optimize expression conditions through factorial design experiments testing variables such as culture media composition, induction timing, and cell density at induction.

  • Activity preservation: Maintaining enzymatic activity throughout purification.

    • Solution: Minimize freeze-thaw cycles, purify at 4°C, and verify activity at each purification step using spectrophotometric assays to track cytochrome c oxidation capability .

These strategies can significantly improve the yield and quality of purified recombinant chicken COII for subsequent functional and structural studies.

How can I optimize the expression of soluble chicken COII in bacterial systems?

Optimizing soluble expression of chicken COII in bacterial systems requires a systematic approach addressing multiple variables:

  • Strain selection: E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), often yield better results than standard BL21(DE3) strains for cytochrome proteins.

  • Expression vector choice: Vectors with tightly controlled promoters like pET-32a allow for careful regulation of expression rates, which can improve protein folding and solubility .

  • Fusion partner strategy: N-terminal fusion tags that enhance solubility, such as:

    • Thioredoxin (Trx)

    • Glutathione S-transferase (GST)

    • Maltose-binding protein (MBP)

    • SUMO protein

    These fusion partners can significantly increase soluble expression compared to simple His-tagged constructs.

  • Induction protocol optimization:

    • Reduce IPTG concentration to 0.1-0.5 mM

    • Lower induction temperature to 16-20°C

    • Extend induction time to 16-20 hours

    • Induce at lower cell density (OD₆₀₀ = 0.4-0.6)

  • Media supplementation: Adding cofactors such as δ-aminolevulinic acid (ALA) as a heme precursor and trace metal solutions containing copper can improve folding of cytochrome proteins.

  • Co-expression strategies: Co-express with chaperone proteins like GroEL/GroES, DnaK/DnaJ/GrpE, or specific cytochrome maturation proteins.

Implementing these strategies in combination, rather than individually, typically yields the best results. A factorial experimental design testing combinations of strain, temperature, and IPTG concentration can efficiently identify optimal conditions for your specific construct.

What methods can be used to study the redox properties of recombinant chicken COII?

Studying the redox properties of recombinant chicken COII requires specialized techniques that can probe electron transfer mechanisms and redox center characteristics:

  • Cyclic voltammetry: This electrochemical technique can determine the redox potential of the CuA center in COII. The experimental setup typically uses a three-electrode system with protein immobilized on a modified working electrode surface.

  • EPR spectroscopy: Electron paramagnetic resonance can directly probe the electronic structure of the copper centers in COII, providing information about the coordination environment and oxidation states of the metal ions.

  • Stopped-flow spectrophotometry: This rapid-kinetics technique can measure the rates of electron transfer between COII and its substrates by monitoring absorbance changes on millisecond timescales.

  • Potentiometric titrations: By progressively changing the redox potential of the solution containing COII using titrants while monitoring spectral changes, the midpoint potentials of the redox centers can be determined.

  • Raman spectroscopy: Resonance Raman spectroscopy can provide information about the vibrational modes of metal-ligand bonds in the copper centers of COII.

These techniques can reveal crucial information about the highly conserved redox center of chicken COII, which includes the invariant cysteine and histidine residues that coordinate copper ions and the conserved acidic residues involved in cytochrome c binding .

How can molecular modeling be used to study chicken COII structure and interactions?

Molecular modeling provides powerful approaches for studying chicken COII structure and interactions when experimental structural data may be limited:

  • Homology modeling: Create a structural model of chicken COII using known structures of COII from other species as templates. The relatively high sequence homology (64-66% amino acid sequence homology with other vertebrates) makes this approach feasible.

  • Molecular dynamics simulations: Simulate the behavior of COII in a membrane or solution environment to understand conformational dynamics, especially in the conserved functional domains.

  • Protein-protein docking: Model interactions between COII and cytochrome c or other components of the respiratory chain to identify key interaction residues. This approach can highlight the role of the three strictly conserved glutamic acid or aspartic acid residues implicated in cytochrome c binding .

  • Virtual screening: Identify potential inhibitors or modulators of COII activity by computationally screening compound libraries against the active site model.

  • Quantum mechanical calculations: Apply quantum chemistry methods to model the electron transfer process through the redox center, particularly involving the copper coordination sites formed by the invariant cysteine and histidine residues .

  • Mutant modeling: Predict the structural and functional consequences of mutations, particularly in the four highly conserved nine-amino-acid segments, before experimental validation.

Molecular docking studies have already revealed potential interaction mechanisms, such as the formation of hydrogen bonds between small molecules and specific residues in COII proteins , demonstrating the utility of this approach.

What are the most effective methods for analyzing the integration of chicken COII into functional respiratory complexes?

Analyzing the integration of chicken COII into functional respiratory complexes requires techniques that bridge molecular and cellular scales:

  • Blue Native PAGE: This technique allows separation of intact respiratory complexes while preserving their native state and can be followed by second-dimension SDS-PAGE to identify individual components, including COII.

  • Proteoliposome reconstitution: Purified COII can be reconstituted with other purified components of cytochrome c oxidase into artificial membrane systems to assess complex assembly and function.

  • Super-resolution microscopy: Techniques like STORM or PALM with fluorescently tagged COII can visualize its distribution and colocalization with other respiratory complex components in mitochondria.

  • Cryo-electron tomography: This technique can visualize the organization of respiratory complexes within the mitochondrial membrane at nanometer resolution.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry can identify residues at protein-protein interfaces, elucidating how COII interacts with other subunits within the cytochrome c oxidase complex.

  • Respiratory chain activity assays: Measuring the activity of reconstituted complexes or isolated mitochondria can assess how efficiently COII is incorporated into functional respiratory assemblies.

  • In organello translation: Studying the synthesis and assembly of COII in isolated mitochondria can reveal the natural process of complex formation.

These approaches can provide insights into how the highly conserved domains of chicken COII, particularly the redox center formed by three highly conserved domains containing invariant cysteine and histidine residues , contribute to the formation of functional respiratory complexes.

What are common pitfalls in chicken COII functional studies and how can they be avoided?

Researchers working with chicken COII often encounter several challenges that can compromise experimental outcomes:

  • Loss of copper during purification:

    • Problem: The CuA center in COII can lose copper ions during purification, resulting in inactive protein.

    • Solution: Include low concentrations of copper (1-5 μM CuSO₄) in purification buffers and avoid strong chelating agents like EDTA.

  • Aggregation during storage:

    • Problem: Purified COII tends to aggregate during storage, leading to loss of activity.

    • Solution: Store at higher concentrations (>1 mg/mL) with 10-20% glycerol, avoid freeze-thaw cycles, and use small aliquots for single-use storage at -80°C.

  • Oxidative damage:

    • Problem: The redox-active centers are susceptible to oxidative damage during handling.

    • Solution: Include reducing agents like DTT or TCEP in all buffers and perform experiments under nitrogen atmosphere when possible.

  • Substrate quality issues:

    • Problem: Variable quality of cytochrome c used as substrate can lead to inconsistent activity measurements.

    • Solution: Use only high-purity, freshly reduced cytochrome c and standardize reduction protocols using sodium dithionite or ascorbate.

  • Expression of truncated products:

    • Problem: Expression of truncated COII due to premature termination or proteolysis.

    • Solution: Optimize codon usage for heterologous expression, add protease inhibitors during purification, and verify protein integrity by western blotting with antibodies targeting different regions of the protein .

  • Interfering compounds in activity assays:

    • Problem: Buffer components or contaminants interfering with spectrophotometric assays.

    • Solution: Perform control reactions without enzyme and with known inhibitors to identify potential interference sources.

Careful attention to these potential issues can significantly improve the reliability and reproducibility of chicken COII functional studies.

How can genetic diversity analysis of chicken COII be applied to conservation genetics and breeding programs?

Genetic diversity analysis of chicken COII provides valuable insights for conservation genetics and breeding programs:

  • Breed authentication methodology:

    • Develop PCR-RFLP or sequencing protocols targeting polymorphic regions of COII

    • Create reference databases of breed-specific COII haplotypes

    • Establish statistical thresholds for breed assignment based on sequence similarity

  • Genetic diversity assessment for conservation:

    • Calculate haplotype diversity (Hd) metrics for different populations, which can range from 34.50% to 92.70% in native chicken breeds

    • Identify populations with unique haplotypes that require conservation priority

    • Monitor changes in genetic diversity over time through periodic sampling

  • Maternal lineage tracing:

    • As a mitochondrial gene, COII follows maternal inheritance

    • Construct maternal phylogenies to understand the origin and diversification of chicken breeds

    • Identify ancestral relationships to wild populations such as Red Jungle Fowl and Gray Jungle Fowl

  • Integrating with breeding programs:

    • Associate COII haplotypes with performance traits through marker-assisted selection

    • Maintain genetic diversity by selecting breeding stock with diverse COII haplotypes

    • Design crossing schemes that preserve rare haplotypes while improving production traits

  • Developing monitoring protocols:

    • Create standardized sampling and analysis methods for COII that can be applied across different laboratories

    • Establish thresholds for intervention when genetic diversity falls below critical levels

    • Integrate data with other genetic markers for comprehensive breed management

This approach has been demonstrated in studies of native chicken populations, where COII analysis revealed significant differences in genetic diversity between populations such as Aravali (high diversity) and Ankleshwar (low diversity) .

What are the current limitations in our understanding of chicken COII function, and what research directions might address these gaps?

Despite significant advances, several knowledge gaps persist in our understanding of chicken COII:

  • Structure-function relationships:

    • Current limitation: The precise atomic structure of chicken COII remains undetermined, limiting our understanding of species-specific features.

    • Research direction: Apply cryo-electron microscopy to determine high-resolution structures of chicken cytochrome c oxidase complexes, focusing on COII interactions with other subunits.

  • Post-translational modifications:

    • Current limitation: The role of post-translational modifications in regulating chicken COII function is poorly characterized.

    • Research direction: Apply comprehensive proteomic approaches to identify and characterize PTMs on COII across different tissues and physiological states.

  • Tissue-specific expression patterns:

    • Current limitation: Variation in COII expression across different chicken tissues and developmental stages is incompletely documented.

    • Research direction: Perform systematic transcriptomic and proteomic analyses across tissues and developmental timepoints.

  • Functional consequences of genetic variation:

    • Current limitation: Despite documented genetic diversity , the functional impact of natural COII variants remains largely unexplored.

    • Research direction: Express and characterize recombinant COII variants representing different haplotypes to assess kinetic and stability differences.

  • Interaction with environmental factors:

    • Current limitation: How environmental factors (temperature, diet, stress) affect COII expression and function in chickens is poorly understood.

    • Research direction: Design controlled studies examining COII expression and activity under various environmental conditions.

  • Role in disease resistance:

    • Current limitation: The potential role of COII in disease resistance, particularly against viral infections, requires further investigation.

    • Research direction: Explore the relationship between COII variants and susceptibility to avian viral diseases, building on emerging evidence of cytochrome c oxidase involvement in viral replication .

Addressing these knowledge gaps would significantly advance our understanding of chicken COII function and potentially lead to applications in poultry breeding, health management, and comparative biochemistry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.