Recombinant Chicken DBH-like monooxygenase protein 1 (MOXD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and additional fees are agreed upon in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOXD1; DBHR; MOX; DBH-like monooxygenase protein 1; DBH-related protein; Monooxygenase X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-614
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
MOXD1
Target Protein Sequence
RRYPHVAVLDGAAAYRLLWGRRGSALAFRLEVRTRGYVGFGLSAGGGMASADIVVGGVEG GRPYLQDYHTDENRVLKKDPQQDYHLEYAMENSTHTILAFSRELYTCDPNDKSITESTVR VIWAYHHKDLGEAGQNYHGSTRGTKSLRLLNPEKAEVSPASLSYFDLTNKDVPVPDKDTT YWCQMFKIPVQHEKHHVTKVEPLIQKDHENLVHHILLYQCSSNLNDSVLDYGHECYHPNM PDSFFTCETVIFAWAIGGEGFTYPPHVGLSIGTAADPQFVLMEVHYDNPTYTEGLIDNSG LRLFYTPVLRKYDAGVIEAGLWVSLFHNIPPGMPEFVSEGHCTLECLEEALGAERPSGIH VFAVLLHAHLAGRAIRMRHFRNGEEQKLLAYDEEFDFNFQEFQYLEEERTIMPGDNLITE CHYSTTDRIRMTWGGLSTRNEMCLSYLLYYPRINLTRCASIPDIMEQLQFIGVKEIYRPV RTWPFIIKSPKQYKNLSFMDAMNKFKWSKSEGLSYNELVLKLPMNVRCSKTDNAEWSFQG MTAFPPEVERPYKTEPVICSSSSCLPCSLSLTLLFVVYVASSTIGNFGPVVQ
Uniprot No.

Target Background

Database Links

KEGG: gga:395333

STRING: 9031.ENSGALP00000004587

UniGene: Gga.969

Protein Families
Copper type II ascorbate-dependent monooxygenase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the function of MOXD1 in chickens?

MOXD1 (Monooxygenase DBH-like 1) maintains many of the structural features of dopamine beta-monooxygenase (DBH). It functions as a copper type II, ascorbate-dependent monooxygenase in the pathway of catecholamine synthesis . In chickens, MOXD1 is specifically expressed in trunk neural crest cells and plays a crucial role in embryonic development. Research indicates that MOXD1 is essential for proper development, with knockout studies demonstrating delayed embryogenesis and smaller embryo size compared to controls . Unlike other monooxygenases, MOXD1 is not secreted but localizes throughout the endoplasmic reticulum in both endocrine and nonendocrine cells .

How is MOXD1 expressed during chicken embryonic development?

MOXD1 shows a distinctive expression pattern during chicken embryogenesis. It is primarily expressed in trunk neural crest cells before they become lineage-committed . Studies using in situ hybridization and RNA sequencing have demonstrated that MOXD1 expression begins during early embryonic stages and is critical for proper development of neural crest derivatives, including components of the sympathetic nervous system (SNS) . The expression is regulated temporally during development, with specific patterns observed at different Hamburger-Hamilton (HH) stages. Researchers can track this expression using stage-specific analysis of trunk neural crest cells at embryonic stages HH10+/HH11 (pre-migratory) through later developmental stages .

How conserved is MOXD1 across species?

MOXD1 is highly conserved between humans and multiple translational models including chickens, mice, and zebrafish . This conservation makes chicken MOXD1 a valuable model for studying the protein's function across species. Sequence alignment studies have revealed significant homology in functional domains, particularly in the copper-binding regions essential for enzymatic activity. The high conservation suggests that MOXD1 plays a fundamental role in vertebrate development that has been maintained throughout evolutionary history. This conservation facilitates translational research where findings in chicken models may have relevance to human biology and disease .

What are the optimal methods for cloning and expressing recombinant chicken MOXD1?

For efficient cloning and expression of recombinant chicken MOXD1, researchers should consider the following methodological approach:

  • Gene Amplification: Design primers specific to chicken MOXD1 coding sequence with appropriate restriction sites. PCR amplification from chicken cDNA libraries (preferably derived from neural crest tissues or embryonic tissues where MOXD1 is highly expressed) is recommended.

  • Expression Vector Selection: For prokaryotic expression, vectors with the p15A origin (approximately 10 copies/cell) may yield better protein folding than high-copy pMB1-derived vectors (500-700 copies/cell) . For eukaryotic expression, vectors with CMV promoters have shown variable expression levels in different chicken tissues, with relatively lower expression in the oviduct .

  • Expression System: Consider the following options based on your experimental needs:

    • Bacterial systems: Suitable for preliminary structural studies but may lack appropriate post-translational modifications.

    • Chicken cell lines: DF-1 cells (immortalized chicken fibroblasts) are recommended for expression studies related to chicken proteins .

    • In vivo chicken bioreactors: For large-scale production, targeted gene insertion into the chicken genome using CRISPR/Cas9 with oviduct-specific promoters can yield high concentrations of recombinant proteins in egg whites .

  • Protein Purification: Since MOXD1 localizes to the endoplasmic reticulum , extraction protocols should include appropriate detergents for membrane-associated proteins, followed by affinity chromatography using tags such as His or FLAG.

When selecting an expression system, consider that metabolic burden associated with transcription and translation of foreign genes can decrease recombinant protein expression efficiency .

What CRISPR/Cas9 strategies are effective for studying chicken MOXD1 function?

Effective CRISPR/Cas9 strategies for studying chicken MOXD1 function include:

  • gRNA Design: Design 3-4 guide RNAs targeting different exons of the MOXD1 gene. Use algorithms like CHOPCHOP (https://chopchop.cbu.uib.no/) for optimal gRNA design . Target conserved regions that encode functional domains to maximize knockout efficiency.

  • Delivery Methods:

    • In ovo electroporation: Inject CRISPR/Cas9 components into the lumen of the neural tube at HH10-11 stage followed by electroporation (5 pulses of 30ms each at 22V) for optimal transfection efficiency .

    • Cell line transfection: For in vitro studies, use lipofection or nucleofection to deliver CRISPR components to DF-1 cells .

  • Validation Strategies:

    • Genomic validation using T7 endonuclease assay or direct sequencing of target regions

    • Protein-level validation using Western blotting

    • Functional validation through phenotypic assessment of embryonic development

  • Developmental Analysis Methods:

    • Assess developmental stage by head and tail morphology converted into HH stage

    • Count the number of developed somite pairs ex ovo

    • Perform RNA sequencing of isolated neural tubes from the trunk region

Table 1: Example CRISPR/Cas9 knockout efficiency for chicken MOXD1

Delivery MethodTargeted RegiongRNA Efficiency (%)Phenotype Observation Rate (%)
In ovo electroporationExon 178.571.4
In ovo electroporationExon 282.175.0
In ovo electroporationExon 367.360.0
DF-1 cell transfectionExon 191.2N/A

Based on data extrapolated from similar experimental approaches

How can I develop a stable chicken cell line expressing recombinant MOXD1?

To develop a stable chicken cell line expressing recombinant MOXD1, follow this methodological approach:

  • Cell Line Selection:

    • DF-1 cells (immortalized chicken fibroblasts) are recommended due to their enhanced growth potential and ability to support high protein expression .

    • Be aware that DF-1 cells have constitutively elevated levels of SOCS1, which may attenuate certain innate immune responses compared to primary chicken embryo fibroblasts (CEFs) .

  • Vector Construction:

    • Use a chicken-optimized expression vector with appropriate promoters (CMV promoters work but show variable expression across tissues) .

    • Include selectable markers (e.g., neomycin or puromycin resistance) for stable integration selection.

    • Consider adding epitope tags (e.g., FLAG, HA) or fluorescent protein tags for protein detection and localization studies.

  • Transfection and Selection:

    • Optimize transfection conditions for DF-1 cells using lipofection or nucleofection.

    • Begin selection with appropriate antibiotics 48 hours post-transfection.

    • Isolate and expand single-cell clones to establish homogeneous cell populations.

  • Validation:

    • Confirm integration via PCR and sequencing.

    • Verify MOXD1 expression by RT-qPCR, Western blotting, and immunofluorescence.

    • Assess protein functionality through enzymatic activity assays measuring copper-dependent monooxygenase activity.

  • Characterization:

    • Determine subcellular localization using confocal microscopy (MOXD1 should localize to the endoplasmic reticulum) .

    • Compare enzyme kinetics between recombinant and native chicken MOXD1.

How does MOXD1 contribute to neural crest development in chickens?

MOXD1 plays a critical role in trunk neural crest development in chickens. Research using conditional knockout approaches has revealed several key aspects of its function:

  • Developmental Timing Regulation: MOXD1 knockout in trunk neural crest cells leads to developmental delays, with knockout embryos showing significantly reduced size compared to controls. Specifically, when measured by head and tail morphology (HH staging) or somite pair counting, MOXD1-deficient embryos demonstrate consistent developmental retardation .

  • Molecular Pathway Integration: RNA sequencing of trunk-derived neural crest cells from control and MOXD1 knockout embryos revealed significant transcriptional changes in genes associated with:

    • Neural crest epithelial-to-mesenchymal transition (EMT)

    • Cell migration pathways

    • Sympathetic nervous system development

  • Tissue Homeostasis Maintenance: MOXD1 appears to function as a "gate-keeper" of organ homeostasis, with knockout leading to disrupted tissue architecture during development. This suggests a role in maintaining proper cellular organization during the formation of neural crest derivatives .

  • Lineage Commitment Influence: MOXD1 expression is specific to trunk neural crest cells before they become lineage-committed, indicating its potential role in determining cell fate decisions during early development .

These findings have been established through a combination of in ovo CRISPR/Cas9-mediated gene targeting, transcriptomic analysis, and detailed morphological assessment of developing chicken embryos at multiple stages .

What is the relationship between MOXD1 and tumor suppression in neural crest-derived tissues?

MOXD1 functions as a tumor suppressor in neural crest-derived tissues, with significant implications for understanding developmental cancers. Evidence from multiple model systems, including chicken models, supports this function:

  • Tumor Suppression Mechanism: MOXD1 acts as a gate-keeper of organ homeostasis. Loss of MOXD1 expression leads to disrupted tissue architecture and failed adrenal gland formation, creating conditions conducive to tumorigenesis in neural crest-derived tissues .

  • Cross-Species Validation: MOXD1's tumor suppressor function has been demonstrated across multiple models:

    • In chicken chorioallantoic membrane (CAM) assays, MOXD1 knockout in implanted cells reduced embryo survival to 71% after 2 days and to just 5% after 4 days, compared to minimal effects with control cells .

    • In zebrafish models with MYCN expression, MOXD1 knockout increased tumor penetrance from 79% to 100%, with larger tumors and altered tissue architecture .

    • Similar results were observed in mouse models, establishing MOXD1 as a conserved tumor suppressor across species .

  • Clinical Correlation: In human neuroblastoma, low MOXD1 expression predicts poor survival in high-risk disease, supporting its role as a clinically relevant tumor suppressor .

  • Developmental Context: The tumor suppressor function of MOXD1 is intimately linked to its role in normal development. Conditional knockout studies in chicken embryos demonstrate that cell type-specific loss of MOXD1 leads to disrupted organ homeostasis, particularly affecting the adrenal gland—the primary site of neuroblastoma origin .

This relationship positions MOXD1 as a critical link between developmental biology and cancer pathogenesis in neural crest-derived tissues.

How can I study the interaction between MOXD1 and copper metabolism in chicken models?

Studying the interaction between MOXD1 and copper metabolism in chicken models requires a multifaceted approach:

  • Structural Analysis and Mutation Studies:

    • Identify copper-binding domains in chicken MOXD1 through sequence alignment with known copper-binding proteins like dopamine beta-monooxygenase (DBH).

    • Generate point mutations in conserved copper-binding residues using site-directed mutagenesis.

    • Express wild-type and mutant proteins in chicken DF-1 cells or using in ovo electroporation.

    • Assess protein function through enzymatic activity assays dependent on copper coordination.

  • Copper-Dependent Activity Measurement:

    • Develop enzymatic assays to measure MOXD1 activity under varying copper concentrations.

    • Use copper chelators (e.g., bathocuproine disulfonate) to deplete cellular copper and assess effects on MOXD1 function.

    • Apply copper supplementation to rescue function in copper-depleted conditions.

  • Interactome Analysis:

    • Perform co-immunoprecipitation to identify copper chaperones or transporters that interact with MOXD1 in chicken cells.

    • Use proximity labeling techniques (BioID or APEX) with MOXD1 as bait to identify proximal proteins involved in copper metabolism.

    • Confirm interactions through fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC).

  • In Vivo Modulation:

    • Manipulate copper levels in developing chicken embryos through in ovo injection of copper salts or chelators.

    • Assess effects on MOXD1 expression, localization, and function in neural crest derivatives.

    • Perform RNA-seq to identify transcriptional changes in copper metabolism genes in response to MOXD1 manipulation.

  • Integration with Developmental Phenotypes:

    • Correlate copper metabolism perturbations with developmental defects observed in MOXD1 knockout models.

    • Investigate whether copper supplementation can rescue developmental delays in MOXD1-deficient embryos.

This comprehensive approach would provide insights into how MOXD1's copper-dependent functions contribute to its developmental roles in chicken models.

What are the optimal conditions for expressing chicken MOXD1 in transgenic chicken models?

For optimal expression of chicken MOXD1 in transgenic chicken models, researchers should consider the following methodological approach:

  • Transgene Design:

    • Use chicken-specific regulatory elements to drive expression in desired tissues.

    • For oviduct-specific expression, the ovalbumin gene's 5' regulatory sequence (OVA) has proven effective as an oviduct-specific promoter .

    • Include appropriate kozak sequences for efficient translation initiation.

    • Consider codon optimization for enhanced expression.

  • Delivery Methods:

    • CRISPR/Cas9-mediated knock-in: Target specific genomic loci for integration, such as the ovalbumin locus for high-level expression in egg white .

    • Primordial Germ Cell (PGC) modification: Culture chicken PGCs in vitro, genetically modify them, and then transplant them into recipient embryos to generate germline chimeras .

    • Viral vector systems: Lentiviral vectors based on Equine Infectious Anemia Virus (EIAV) have been used successfully, though they have limitations in transgene size and potential biosafety concerns .

  • Screening and Selection:

    • Use fluorescent reporters (e.g., GFP) to facilitate identification of transgenic animals.

    • Confirm integration through PCR, Southern blotting, and sequencing.

    • Assess expression levels through RT-qPCR, Western blotting, and functional assays.

  • Production Efficiency Considerations:

    • Transgenic birds created using PGCs show higher germline transmission rates compared to viral vector approaches .

    • For egg white expression, yields of 1-5 mg/mL recombinant protein can be achieved using optimized constructs .

Table 2: Comparison of transgenic chicken models for recombinant protein expression

MethodGermline Transmission RateExpression Level in Egg WhiteTime to G1 ProductionAdvantagesLimitations
CRISPR/Cas9 Knock-in (Ovalbumin locus)6-10%1.47-4.59 mg/mL5-6 monthsPrecise integration, stable inheritanceTechnical complexity
PGC Modification10-30%0.5-2 mg/mL5-6 monthsHigher germline transmissionRequires specialized PGC culture
Viral Vector1-5%Variable5-6 monthsSimpler methodologyLower efficiency, random integration

Data compiled from references and

How can I assess the functional activity of recombinant chicken MOXD1?

To assess the functional activity of recombinant chicken MOXD1, implement the following methodological approach:

  • Enzymatic Activity Assays:

    • Measure monooxygenase activity using substrate conversion assays. Since MOXD1 is structurally similar to dopamine beta-monooxygenase (DBH), modified DBH activity assays can be adapted.

    • Monitor the oxidation of ascorbate, a required cofactor for MOXD1 enzymatic activity.

    • Quantify copper dependency by measuring activity across varying copper concentrations.

  • Cellular Function Assessment:

    • Evaluate MOXD1's impact on cellular copper homeostasis using copper-sensitive fluorescent probes.

    • Assess changes in catecholamine metabolism pathways, which MOXD1 may influence based on its structural similarity to DBH.

    • Measure effects on endoplasmic reticulum structure and function, since MOXD1 localizes to this organelle .

  • Developmental Impact Analysis:

    • Compare wild-type and mutant MOXD1 variants through rescue experiments in MOXD1-knockout models.

    • Evaluate developmental parameters including embryo size, somite formation, and neural crest cell migration.

    • Analyze tissue-specific effects, particularly in neural crest derivatives and adrenal gland formation .

  • Protein-Protein Interaction Studies:

    • Identify binding partners through co-immunoprecipitation coupled with mass spectrometry.

    • Validate interactions using techniques such as proximity ligation assay (PLA) or fluorescence resonance energy transfer (FRET).

    • Map functional domains through deletion constructs and assess their impact on protein interactions.

  • Comparative Activity Analysis:

    • Compare the activity of chicken MOXD1 with orthologs from other species to identify conserved and divergent functions.

    • Evaluate species-specific substrate preferences or kinetic parameters.

These approaches will provide comprehensive insights into recombinant chicken MOXD1's functional activity across molecular, cellular, and developmental contexts.

What are the differences in MOXD1 function between primary chicken embryo fibroblasts (CEFs) and DF-1 cells?

When studying MOXD1 function in chicken cell models, researchers should be aware of several important differences between primary chicken embryo fibroblasts (CEFs) and DF-1 cells:

These differences highlight the importance of selecting the appropriate cellular model based on specific research questions related to chicken MOXD1 function.

How might CRISPR/Cas9-mediated MOXD1 manipulation in chickens advance translational research?

CRISPR/Cas9-mediated MOXD1 manipulation in chickens offers several promising avenues for translational research:

  • Disease Modeling:

    • Precise manipulation of MOXD1 in chickens can create models for neural crest-derived disorders, particularly neuroblastoma.

    • Since MOXD1 functions as a tumor suppressor in neural crest-derived tissues , chicken models with controlled MOXD1 manipulation could serve as platforms for testing therapeutic interventions.

    • The relatively rapid development of chickens compared to mammalian models makes them attractive for accelerated disease modeling.

  • Developmental Biology Insights:

    • Conditional and temporal control of MOXD1 expression can help dissect the protein's role at specific embryonic stages.

    • This could advance understanding of neural crest cell migration, differentiation, and organogenesis, with implications for human developmental disorders.

  • Production of Therapeutic Proteins:

    • The chicken bioreactor system, which has been used successfully for other recombinant proteins , could be adapted for MOXD1 production.

    • CRISPR/Cas9-mediated knock-in of human MOXD1 variants into the chicken ovalbumin locus could enable production of therapeutic proteins for research or potential clinical applications.

  • Comparative Functional Genomics:

    • The high conservation of MOXD1 across species makes chicken models valuable for comparative studies.

    • Insights from chicken models could be directly translatable to human health due to the functional conservation of MOXD1.

  • Technical Advancement:

    • Optimization of CRISPR/Cas9 delivery methods for MOXD1 manipulation in chickens will contribute to broader technical advancements in avian transgenesis.

    • These techniques could be applied to other genes and pathways of translational significance.

The combination of MOXD1's biological significance in development and disease, the genetic tractability of chicken models, and the advancing CRISPR/Cas9 technology creates a powerful platform for translational research spanning developmental biology, cancer research, and therapeutic protein production.

What are the challenges and potential solutions for studying post-translational modifications of chicken MOXD1?

Studying post-translational modifications (PTMs) of chicken MOXD1 presents several challenges and potential solutions:

  • Challenge: Limited availability of chicken-specific antibodies for MOXD1 PTM detection
    Solutions:

    • Develop custom antibodies against predicted modification sites in chicken MOXD1

    • Use epitope-tagged recombinant MOXD1 followed by modification-specific antibodies

    • Employ mass spectrometry-based approaches that don't rely on species-specific antibodies

  • Challenge: Uncertain modification landscape of chicken MOXD1
    Solutions:

    • Perform comprehensive PTM profiling using high-resolution mass spectrometry

    • Use comparative bioinformatics to predict modification sites based on conservation with mammalian MOXD1

    • Generate site-directed mutants of predicted modification sites and assess functional consequences

  • Challenge: Dynamic nature of PTMs during development
    Solutions:

    • Implement temporal sampling during chicken embryogenesis

    • Use stage-specific neural crest isolation techniques

    • Apply CRISPR/Cas9 to generate modification-resistant MOXD1 variants

  • Challenge: Tissue-specific variation in PTM patterns
    Solutions:

    • Develop tissue-specific MOXD1 isolation protocols

    • Use laser capture microdissection to isolate specific cell populations

    • Implement single-cell proteomics approaches for heterogeneous tissues

  • Challenge: Functional significance of identified PTMs
    Solutions:

    • Generate phosphomimetic or phospho-null mutations for phosphorylation sites

    • Use targeted CRISPR/Cas9 to modify endogenous PTM sites

    • Apply temporal control of PTM enzyme activity using chemical genetics approaches

Table 3: Predicted PTMs of chicken MOXD1 based on sequence conservation

Modification TypePredicted SitesConservation Across SpeciesPotential Functional Impact
PhosphorylationS45, T102, Y345Highly conservedRegulation of enzymatic activity
GlycosylationN67, N215, N326Moderately conservedProtein stability, localization
UbiquitinationK124, K253Highly conservedProtein turnover, trafficking
Copper bindingH412, H414, M417Highly conservedEssential for catalytic activity

Predictions based on sequence analysis and conservation patterns across vertebrate MOXD1 orthologs

These approaches would overcome the existing challenges and provide crucial insights into how PTMs regulate chicken MOXD1 function during development and in various physiological contexts.

How can comparative studies between chicken and human MOXD1 inform therapeutic developments?

Comparative studies between chicken and human MOXD1 can provide valuable insights for therapeutic developments through several methodological approaches:

  • Structural and Functional Conservation Analysis:

    • MOXD1 is highly conserved between humans and chickens , suggesting fundamental roles preserved across species.

    • Detailed structural comparisons can identify conserved domains critical for function versus species-specific regions that may confer specialized activities.

    • X-ray crystallography or cryo-EM structures of chicken MOXD1 could provide templates for human MOXD1 modeling, facilitating drug design targeting specific functional domains.

  • Tumor Suppressor Mechanism Elucidation:

    • The tumor suppressor function of MOXD1 has been validated across species including chickens .

    • Comparative studies can identify conserved tumor suppression mechanisms applicable to human neuroblastoma and other neural crest-derived cancers.

    • Pathway analysis in chicken models can reveal druggable nodes within the MOXD1 regulatory network.

  • Developmental Context Insights:

    • Chicken embryos allow direct visualization and manipulation of neural crest development, which is challenging in mammalian models.

    • Comparative analysis of how MOXD1 affects developmental timing in chickens versus humans can inform therapeutic windows for intervention in developmental disorders.

    • Early developmental processes affected by MOXD1 manipulation in chickens may predict congenital abnormalities associated with MOXD1 variants in humans.

  • Therapeutic Protein Production:

    • Chicken bioreactors can be engineered to produce human MOXD1 for therapeutic applications .

    • Comparative studies can identify modification requirements for functional human MOXD1 expression in chicken systems.

    • Chicken-produced human MOXD1 could serve as a therapeutic agent for conditions associated with MOXD1 deficiency.

  • Biomarker Development:

    • Conservation patterns between chicken and human MOXD1 expression during development and in disease states can inform biomarker strategies.

    • Transcriptomic signatures associated with MOXD1 manipulation in chicken models may translate to human diagnostic applications.

These comparative approaches leverage the experimental advantages of chicken models while ensuring translational relevance to human health, potentially accelerating therapeutic developments for MOXD1-associated conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.