Recombinant Chicken Dynamin-like 120 kDa protein, mitochondrial (OPA1)

Shipped with Ice Packs
In Stock

Description

Introduction to Chicken OPA1

Dynamin-like 120 kDa protein, mitochondrial, commonly known as OPA1, is a nuclear-encoded mitochondrial protein that belongs to the dynamin-related GTPase family. In chickens, as in other vertebrates, OPA1 serves as a critical component of the mitochondrial network, primarily localizing to the inner mitochondrial membrane where it regulates mitochondrial fusion and cristae structure . The protein derives its name from its association with autosomal dominant optic atrophy (DOA) in humans, a condition characterized by progressive vision loss due to degeneration of retinal ganglion cells and the optic nerve .

OPA1 in chickens appears to share significant homology with its mammalian counterparts, suggesting evolutionary conservation of its core functions across species. While extensive research has been conducted on human and mouse OPA1, investigations specifically focusing on chicken OPA1 are more limited. Nevertheless, the available evidence indicates that chicken OPA1 plays crucial roles in avian physiology, particularly in the context of energy metabolism regulation and adaptation to environmental stressors such as hypoxia .

Understanding the structure, function, and regulation of recombinant chicken OPA1 provides valuable insights into both fundamental mitochondrial biology and species-specific adaptations in avian systems. This knowledge has potential applications in various fields, including poultry science, comparative physiology, and biomedical research.

Protein Domains and Organization

The molecular structure of chicken OPA1 is believed to share significant similarities with human and other mammalian versions of the protein due to evolutionary conservation. Based on homology modeling studies of OPA1 in other species, the chicken protein likely consists of several important domains including a GTPase domain, a middle domain, and a C-terminal region that contribute to its functional properties .

The GTPase domain is critical for the protein's role in mitochondrial fusion, while the C-terminal region contains important cysteine residues that may be involved in redox regulation, similar to what has been observed in mammalian OPA1 . In human OPA1, cysteine residues in the C-terminus (such as C786, C853, C856, and C874) have been shown to be exposed to the solvent and susceptible to oxidation, particularly during conditions like heart ischemia-reperfusion . These cysteine residues are conserved between human and mouse OPA1, suggesting they may also be present in the chicken protein .

Membrane Interaction and Lipid Binding

A particularly notable structural feature identified in OPA1 that is likely conserved in the chicken homolog is the lipid-binding paddle domain (PD). This domain contains a membrane-inserting loop (MIL) that embeds deeply into cardiolipin-containing membranes, which are abundant in the inner mitochondrial membrane . The membrane-binding and membrane-remodeling activities of OPA1 are critically dependent on this domain and specific residues within it .

Research on human OPA1 has shown that several residues in the docking region, particularly Lys738, Arg857, and Arg858, are required for the protein to bind to membranes . Additionally, the MIL (residues 770 to 782 in human OPA1) plays a crucial role in membrane binding and remodeling, with mutations in this region abolishing these activities . While specific information about these residues in chicken OPA1 is limited, the functional importance of these domains suggests similar features may exist in the avian protein.

Protein Isoforms and Processing

In humans, OPA1 exists in multiple isoforms resulting from alternative splicing and proteolytic processing. There are two main types: long isoforms (L-OPA1) that attach to the inner mitochondrial membrane and short isoforms (S-OPA1) that localize to the intermembrane space near the outer mitochondrial membrane . The S-OPA1 forms are created by proteolysis of L-OPA1 at specific cleavage sites (S1 and S2) by the proteases OMA1 and YME1L1, removing the transmembrane domain .

While specific information about chicken OPA1 isoforms is limited in the available data, it is reasonable to hypothesize that similar processing mechanisms may exist in avian species due to the protein's conserved nature across vertebrates.

Regulation of Mitochondrial Dynamics

OPA1 plays a critical role in mitochondrial fusion, working in cooperation with other fusion proteins such as mitofusins (MFN1 and MFN2) . This fusion process is essential for maintaining a healthy mitochondrial network, allowing the exchange of materials between mitochondria and mitigating the effects of damaged mitochondrial components.

In chickens, as in other vertebrates, the balance between mitochondrial fusion and fission is crucial for cellular health and energy production. OPA1 mediates fusion of the inner mitochondrial membrane, while mitofusins facilitate fusion of the outer membrane . This coordinated process allows mitochondria to form interconnected networks that can efficiently respond to cellular energy demands.

Cristae Structure Maintenance

One of the key functions of OPA1 is the regulation of cristae structure in the inner mitochondrial membrane . The cristae are the folded internal compartments of mitochondria where oxidative phosphorylation takes place. OPA1 mediates cristae remodeling through the oligomerization of both long and short forms of the protein, which then interact with other protein complexes to alter cristae structure .

The oligomerization of OPA1 (typically involving two L-OPA1 and one S-OPA1 molecules) stabilizes the cristae junctions, which are narrow tubular openings connecting the cristae to the intermembrane space . This structural organization is crucial for efficient energy production and for preventing the release of pro-apoptotic factors such as cytochrome c during cellular stress.

Energy Metabolism Regulation

Through its roles in maintaining cristae structure and mitochondrial network integrity, OPA1 contributes significantly to energy metabolism regulation . Studies suggest that OPA1 is required to maintain mitochondrial activity during periods of low-energy substrate availability. Under stress conditions, OPA1 oligomerization leads to tightening of the cristae, enhanced assembly of ATP synthase, and increased ATP production .

In the context of chicken physiology, OPA1 appears to be particularly important for metabolic adaptation to environmental stressors. Research comparing Tibetan chickens (TBCs) to domestic lowland chickens (DLCs) found that TBCs had increased mitochondrial content, increased mitochondrial aspect ratio, and higher expression levels of mitochondrial fusion proteins including OPA1 . This suggests that OPA1-mediated mitochondrial fusion may help TBCs adapt to the hypoxic conditions of high-altitude environments by modulating energy metabolism pathways .

Comparative Analysis Between Chicken Breeds

A notable study comparing Tibetan chickens (TBCs) to domestic lowland chickens (DLCs) found significant differences in mitochondrial morphology and the expression of mitochondrial fusion proteins, including OPA1 . TBCs, which have adapted to the hypoxic conditions of high-altitude environments, showed several distinct characteristics:

  1. Increased mitochondrial content

  2. Enhanced mitochondrial aspect ratio (indicating more elongated mitochondria)

  3. Higher expression levels of MFN1, MFN2, and OPA1 proteins

These findings suggest that TBCs may regulate energy metabolism by increasing the level of mitochondrial fusion through proteins like OPA1, enabling them to adapt to hypoxic conditions . This adaptation mechanism potentially enhances the ability of TBCs to survive in the challenging conditions of the Qinghai-Tibet Plateau by reducing aerobic metabolism and increasing glycolysis .

Table 1: Comparison of Mitochondrial Characteristics Between Chicken Breeds

CharacteristicTibetan Chickens (TBCs)Domestic Lowland Chickens (DLCs)
OPA1 Expression LevelHigherLower
MFN1 and MFN2 ExpressionHigherLower
Mitochondrial ContentIncreasedBaseline
Mitochondrial Aspect RatioIncreasedBaseline
Metabolic AdaptationReduced aerobic metabolism, increased glycolysisMore reliant on aerobic metabolism
Hypoxia ToleranceEnhancedStandard

Role in Embryonic Development

OPA1 may play important roles in chicken embryonic development, particularly in the context of energy metabolism adaptation to varying oxygen conditions. Studies have found that changing available oxygen during incubation can alter chicken embryo metabolism , suggesting a potential role for OPA1 and mitochondrial dynamics in this process.

The ability of developing chicken embryos to adapt to different oxygen levels may involve modulation of mitochondrial fusion mediated by OPA1, allowing for appropriate metabolic responses to ensure successful development under varying environmental conditions.

Detection and Quantification Methods

Commercial kits are available for the detection and quantification of chicken OPA1, including ELISA (Enzyme-Linked Immunosorbent Assay) kits . These kits provide a means to measure OPA1 protein levels in various chicken tissues or experimental samples, enabling studies of OPA1 expression under different conditions or in different chicken breeds.

Table 2: Methods for Detecting and Analyzing Chicken OPA1

MethodApplicationAdvantagesLimitations
ELISA KitsQuantification of OPA1 protein levelsSpecific, quantitative, commercially availableLimited to protein level detection
Western BlottingProtein detection and semi-quantificationCan detect specific isoforms and processing formsSemi-quantitative, requires specific antibodies
ImmunohistochemistryTissue localizationProvides spatial information within tissuesQualitative, requires specific antibodies
RT-PCR/qPCRmRNA expression analysisSensitive, can detect specific transcript variantsMeasures mRNA not protein, may not reflect protein levels
Mass SpectrometryProtein identification and modification analysisCan identify post-translational modificationsTechnically demanding, requires specialized equipment

Functional Assays

Functional studies of OPA1 often involve assessing its roles in mitochondrial fusion, cristae structure maintenance, and protection against stress-induced damage. Approaches that could be applied to chicken OPA1 include:

  1. Mitochondrial morphology analyses using fluorescence microscopy

  2. Assessment of mitochondrial membrane potential and function

  3. Measurement of ATP production and respiratory chain activity

  4. Analysis of cell survival under stress conditions

  5. Protein-lipid interaction studies, particularly with cardiolipin-containing membranes

In research on human OPA1, mutations in key residues have been studied to determine their effects on membrane binding and remodeling. For example, polyalanine mutations targeting the MIL (residues 770 to 782) along with single-residue mutations within this region abolished the membrane-binding and membrane-remodeling activity of OPA1 . Similar mutation-based approaches could be valuable for studying the functional domains of chicken OPA1.

Key Domains and Their Functional Significance

Based on studies of human and other mammalian OPA1 proteins, several key structural features likely contribute to the function of chicken OPA1:

Table 3: Key Structural Domains of OPA1 and Their Functions

DomainLocationFunctionKey Residues
GTPase DomainN-terminal regionGTP hydrolysis, essential for membrane fusionConserved GTPase motifs
Middle DomainCentral regionMediates protein-protein interactionsNot specified in available data
Paddle Domain (PD)C-terminal regionMembrane binding and remodelingContains membrane-inserting loop (MIL)
C-terminal DomainC-terminusMay be involved in redox regulationContains cysteine residues potentially susceptible to oxidation
Membrane-Inserting Loop (MIL)Within Paddle DomainDeep membrane anchoringContains conserved charged and hydrophobic residues

The paddle domain of OPA1 is particularly important for its function, as it mediates membrane binding and remodeling. Within this domain, the membrane-inserting loop (MIL) plays a crucial role in embedding the protein into cardiolipin-rich membranes . Research on human OPA1 has shown that mutations in the MIL not only affect membrane binding but also impair the protein's ability to remodel membranes and, consequently, to participate in mitochondrial fusion and cristae structure maintenance .

Oligomerization and Functional States

OPA1 functions as an oligomeric complex, with different oligomeric states corresponding to different functional activities. In human OPA1, oligomerization is crucial for cristae junction maintenance and regulation of mitochondrial fusion .

Research has shown that OPA1 dimerization through the paddle domain promotes the helical assembly of a flexible OPA1 lattice on the membrane, which drives mitochondrial fusion in cells . Moreover, the membrane-bending OPA1 oligomer undergoes conformational changes that pull the membrane-inserting loop out of the outer leaflet and contribute to the mechanics of membrane remodeling .

While specific information about chicken OPA1 oligomerization is limited in the available data, the conserved nature of the protein suggests similar mechanisms may operate in avian mitochondria.

Agricultural and Poultry Science Applications

Understanding the role of OPA1 in chicken physiology, particularly in the context of stress adaptation and energy metabolism, could have implications for poultry science and breeding programs. The observation that Tibetan chickens have higher expression of OPA1 and enhanced ability to adapt to hypoxia suggests that OPA1 could be a target for breeding programs aimed at developing chicken strains with improved stress resilience or adaptability to challenging environmental conditions.

Additionally, insights into how OPA1 regulates energy metabolism in chickens could inform nutritional strategies or management practices designed to optimize poultry health and productivity under various environmental conditions.

Comparative Physiology Insights

Comparative studies of OPA1 across species, including chickens and mammals, can provide valuable insights into the evolution of mitochondrial dynamics and energy metabolism regulation. Such studies may reveal both conserved mechanisms and species-specific adaptations that have emerged through evolutionary processes.

The role of OPA1 in hypoxia adaptation in Tibetan chickens is particularly interesting from a comparative physiology perspective, as it provides an example of how mitochondrial dynamics proteins can contribute to species adaptation to challenging environments.

Biomedical Research Applications

While human OPA1 has been extensively studied due to its association with diseases such as dominant optic atrophy , chicken OPA1 could serve as a valuable comparative model for understanding the fundamental functions of this protein in health and disease. The study of chicken OPA1 may provide insights into conserved mechanisms of mitochondrial dynamics that are relevant to human health and disease.

Additionally, the role of OPA1 in protecting against oxidative stress-induced damage makes it a potential target for therapeutic strategies aimed at mitigating mitochondrial dysfunction in various pathological conditions. Understanding how OPA1 structure and function relate to this protective role could inform the development of interventions targeting mitochondrial dynamics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag requirements, please communicate them to us, and we will prioritize the development of your specified tag.
Synonyms
OPA1; RCJMB04_1m16; Dynamin-like 120 kDa protein, mitochondrial; Optic atrophy protein 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
212-977
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
OPA1
Target Protein Sequence
ATDQGYDSDKQYKKVSDKEKIDQLQEELLRTQLKYQRMLERLEKENKELRKLVLQRDDKG IHQRKLKKSLIDMYSEVLDILSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIF PRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRNEIEIRMRNSVKEG CTVSTETISLSVRGPGLQRMVLVDLPGVISTVTSGMAPDTKETIFSISKAYMQNPNAIIL CIQDGSVDAERSIVTDLVSQMDPQGKRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMK ALGYFAVVTGKGNSSESIESIKEYEEEFFQNSKLLKTSMLKAHQVTTKNLSLAVSDCFWK MVRESVEQQADAFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLTQVTPK HWEEILQKTLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAW ETLQEEFSRFMTEQKGKEHDDIFDKLKQAVKEESIKRHKWNERAEDSLRVIQHNALEDRS ISDKQQWDAAIHFMEETLQSRLKDTESVIEDMVGPDWKKRWLYWISRTKEQNIRNETKNE LEKLIKCNEEHAAYLANDEVTTVRKNLEARGITVDPCLIKDTWHQIYRRYFLKTALNHCN LCRRGFYYYQRHFVDSELECNDIVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVL EDFAEDNEKKVKLLTGKRVQLAEDLKKVREIQEKLEAFIEALHQEK
Uniprot No.

Target Background

Function
Dynamin-related GTPase, crucial for maintaining normal mitochondrial morphology by regulating the balance between mitochondrial fusion and fission. It binds lipid membranes enriched in negatively charged phospholipids, such as cardiolipin, and facilitates membrane tubulation. The intrinsic GTPase activity is low and significantly enhanced upon interaction with lipid membranes. It plays a role in remodeling cristae and the release of cytochrome c during apoptosis. An inactive form arises from cleavage at the S1 position by OMA1 following stress conditions that induce loss of mitochondrial membrane potential, leading to a downregulation of mitochondrial fusion.
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion intermembrane space. Mitochondrion membrane.

Q&A

What is the structural organization of chicken OPA1 and how does it compare to mammalian homologs?

Chicken OPA1, like its mammalian counterparts, is a dynamin-like GTPase that mediates mitochondrial inner membrane fusion. The protein contains several key domains, including the N-terminal mitochondrial targeting sequence (MTS), transmembrane domain (TM), GTPase domain, middle domain, and GTPase effector domain (GED). The GTPase and GED domains are particularly essential for mitochondrial fusion activity .

The GTPase domain contains conserved motifs necessary for GTP binding and hydrolysis, while the GED domain plays crucial roles in protein self-assembly and regulation of GTPase activity. Chicken OPA1 shares significant sequence homology with human OPA1, particularly in these functional domains, making it a valuable model for studying conserved mechanisms of mitochondrial dynamics .

Similar to human OPA1, chicken OPA1 likely exists in multiple isoforms resulting from alternative splicing and proteolytic processing. In mammals, OPA1 exists as long membrane-anchored forms (L-OPA1) that mediate mitochondrial fusion and short soluble forms (S-OPA1) released into the intermembrane space that contribute to cristae organization and bioenergetics .

What expression systems are most effective for producing recombinant chicken OPA1?

For recombinant expression of chicken OPA1, several systems have been employed with varying degrees of success:

  • Bacterial expression systems: While cost-effective, bacterial systems often result in inclusion body formation requiring refolding protocols due to OPA1's size and complexity. E. coli BL21(DE3) strains with specialized vectors containing solubility-enhancing tags (MBP, SUMO) can improve yield of soluble protein.

  • Insect cell expression systems: Baculovirus-infected Sf9 or High Five insect cells provide superior post-translational modifications compared to bacterial systems, making them preferable for functional studies of OPA1. This system generally produces properly folded protein with GTPase activity comparable to native OPA1.

  • Mammalian expression systems: HEK293 or CHO cells permit transient or stable expression with native-like post-translational modifications and processing. This approach is particularly valuable when studying interactions with mammalian binding partners or when developing functional assays.

Selection should be based on research goals - bacterial systems for structural studies requiring high protein quantities, and eukaryotic systems for functional analyses requiring native-like modifications and processing .

What purification strategies yield the most active recombinant chicken OPA1?

Purification of recombinant chicken OPA1 requires careful consideration of the protein's structural characteristics and functional requirements. An effective purification protocol typically involves:

  • Affinity chromatography: Initial capture using His-tag, GST-tag, or other fusion tags depending on the expression construct. For His-tagged OPA1, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co2+ resins works effectively.

  • Ion exchange chromatography: Secondary purification step using anion exchange (e.g., Q Sepharose) or cation exchange (e.g., SP Sepharose) depending on the calculated pI of the chicken OPA1 construct.

  • Size exclusion chromatography: Final polishing step to separate monomeric protein from aggregates and to perform buffer exchange into a stabilizing buffer.

Buffer optimization is critical for maintaining OPA1 stability and activity. Most successful preparations utilize buffers containing:

  • 25-50 mM HEPES or Tris-HCl (pH 7.5-8.0)

  • 150-300 mM NaCl or KCl

  • 5-10% glycerol as stabilizer

  • 1-5 mM MgCl₂ (essential for GTPase activity)

  • 1 mM DTT or 0.5 mM TCEP to maintain reduced cysteines

  • Protease inhibitor cocktail during initial lysis steps

For functional studies, it's essential to confirm that the purified protein retains GTPase activity using standard GTPase assays before proceeding with experimental applications .

How can domain-specific mutations in recombinant chicken OPA1 inform our understanding of mitochondrial fusion mechanisms?

Domain-specific mutations in recombinant chicken OPA1 provide powerful tools for dissecting the precise mechanisms of mitochondrial fusion and cristae organization. Research utilizing domain-specific mutations has revealed distinct roles for different OPA1 domains in mitochondrial structure and function:

The GTPase domain mutations (such as those corresponding to human c.899G>A and c.1334G>A mutations) typically affect GTP binding and hydrolysis, which are essential for the membrane fusion activity of OPA1. In contrast, GED domain mutations (similar to human c.2708delTTAG) primarily affect protein-protein interactions and self-assembly properties of OPA1 .

A methodological approach to studying domain-specific effects includes:

  • Design of equivalent mutations: Generate chicken OPA1 constructs with mutations corresponding to known human disease-causing variants in specific domains.

  • Functional complementation assays: Express mutant chicken OPA1 in OPA1-null cells (Opa1-/- MEFs are commonly used) and assess rescue of mitochondrial morphology, respiratory function, and cristae architecture.

  • Biochemical characterization: Measure GTPase activity, lipid binding properties, and oligomerization capacity of purified mutant proteins compared to wild-type.

DomainExample MutationPrimary EffectSecondary EffectsResearch Applications
GTPaseG300E (equivalent to human G300E)Reduced GTP hydrolysisImpaired mitochondrial fusionMechanistic studies of GTP-dependent fusion
MiddleR445H (equivalent to human R445H)Altered protein conformationModified interaction with binding partnersProtein-protein interaction studies
GEDQ785* (equivalent to human Q785*)Truncated protein lacking GEDDisrupted self-assemblyOligomerization and assembly studies

Investigating these domain-specific mutations has revealed that GTPase domain mutants often result in more severe phenotypes, including multisystemic symptoms beyond optic atrophy in human patients, suggesting differential contributions of these domains to OPA1 function in vivo .

What experimental approaches can detect and quantify the interaction between chicken OPA1 and cardiolipin?

The interaction between OPA1 and cardiolipin (CL) is critical for OPA1-mediated membrane fusion. Recent research has shown that CL is important for membrane fusion by OPA1, suggesting that CL deficiency would impair mitochondrial fusion . To investigate this interaction experimentally:

  • Liposome-based assays: Prepare liposomes containing varying concentrations of cardiolipin and other mitochondrial phospholipids. Measure binding of recombinant chicken OPA1 using:

    • Co-sedimentation assays (ultracentrifugation followed by SDS-PAGE analysis)

    • Fluorescence-based approaches (using labeled OPA1 or lipids)

    • Surface plasmon resonance for quantitative binding kinetics

  • GTPase activity modulation: Assess how cardiolipin-containing liposomes affect the GTPase activity of recombinant chicken OPA1 using:

    • Malachite green phosphate release assays

    • HPLC-based nucleotide conversion assays

    • Real-time fluorescent GTP analogs

  • In vitro membrane fusion assays: Using fluorescently labeled liposomes of defined lipid composition to measure OPA1-mediated fusion events in the presence of GTP.

  • Mutagenesis approaches: Identify and mutate potential cardiolipin-binding sites in chicken OPA1 based on sequence homology with known cardiolipin-binding motifs and assess effects on lipid binding and function.

Experimental data indicate that cardiolipin concentrations of 5-20% in liposomes provide optimal conditions for detecting OPA1-CL interactions. The pH and ionic strength of the reaction buffer significantly impact this interaction, with optimal binding typically observed at physiological pH (7.2-7.4) and moderate ionic strength (100-150 mM KCl) .

How do OMA1 and YME1L proteases regulate chicken OPA1 processing, and how can this be studied experimentally?

The proteolytic processing of OPA1 by OMA1 and YME1L proteases is a key regulatory mechanism controlling mitochondrial dynamics. Based on mammalian studies, OMA1 cleaves OPA1 at the S1 site in response to stress conditions like loss of membrane potential, while YME1L constitutively cleaves OPA1 at the S2 site under normal conditions, establishing a balance between long and short OPA1 isoforms .

To study this regulation in chicken OPA1:

  • Reconstitution of proteolytic processing: Co-express recombinant chicken OPA1 with OMA1 and/or YME1L in appropriate cell lines and analyze processing patterns by western blotting. This can be conducted in:

    • OPA1-deficient mammalian cells

    • Insect cells with minimal endogenous processing

    • In vitro using purified components

  • Stress response analysis: Expose cells expressing chicken OPA1 to various stressors that trigger OMA1 activation:

    • CCCP or oligomycin (disrupts mitochondrial membrane potential)

    • Hydrogen peroxide (oxidative stress)

    • Nutrient deprivation

  • Site-directed mutagenesis: Modify putative cleavage sites in chicken OPA1 based on mammalian homology and assess processing patterns.

  • Quantitative proteomics: Use SILAC or TMT labeling coupled with mass spectrometry to identify and quantify specific cleavage products under different conditions.

Experimental evidence indicates that OMA1 activation results in complete processing of L-OPA1 to S-OPA1, inhibiting mitochondrial fusion and promoting fragmentation, while balanced processing by YME1L maintains fusion-competent mitochondria. This proteolytic regulation functions as a key stress-responsive mechanism linking mitochondrial energetic status to morphological adaptations .

What are the key considerations for designing in vitro GTPase assays for chicken OPA1?

Designing robust GTPase assays for chicken OPA1 requires careful consideration of protein structure, reaction conditions, and detection methods:

  • Protein preparation considerations:

    • Use freshly purified protein whenever possible

    • Confirm structural integrity via circular dichroism or thermal shift assays

    • Verify oligomeric state by size exclusion chromatography or analytical ultracentrifugation

    • Include proper controls (GTPase-deficient mutant, heat-inactivated protein)

  • Reaction buffer optimization:

    • Physiological pH (7.2-7.5) using HEPES or Tris buffer (50 mM)

    • Divalent cations: Mg²⁺ (5 mM) is essential; test various concentrations

    • Salt concentration: typically 100-150 mM KCl or NaCl

    • Reducing agents: 1-2 mM DTT or 0.5-1 mM TCEP

    • Temperature: 25-37°C (test for optimal activity)

  • Detection methods:

    • Malachite green assay: measures released phosphate; sensitive but endpoint

    • HPLC analysis: direct quantification of GTP/GDP; accurate but low throughput

    • Coupled enzymatic assays: continuous monitoring of GTP hydrolysis

    • Fluorescent or radioactive GTP analogs: allow real-time measurement

  • Lipid dependence characterization:

    • Test activity with and without liposomes containing cardiolipin

    • Vary cardiolipin concentration (0-20%) to determine optimal conditions

    • Include non-cardiolipin containing liposomes as controls

MethodSensitivityThroughputContinuous/EndpointSpecial Considerations
Malachite GreenHigh (μM range)HighEndpointProne to phosphate contamination
HPLCModerateLowEndpointRequires specialized equipment
Coupled EnzymeHighModerateContinuousPotential interference from coupling enzymes
Fluorescent GTPHighModerateContinuousBackground fluorescence issues

The baseline GTPase activity of wild-type chicken OPA1 is typically in the range of 0.5-2 min⁻¹ under optimal conditions, with significant enhancement observed in the presence of cardiolipin-containing membranes .

How can cristae remodeling activity of chicken OPA1 be assessed in experimental systems?

OPA1 plays a crucial role in maintaining cristae morphology and organization, independent of its role in inner membrane fusion. Assessing this function requires specialized approaches:

  • Electron microscopy-based methods:

    • Transmission electron microscopy (TEM) of cells expressing wild-type vs. mutant chicken OPA1

    • Quantitative analysis of cristae parameters (width, number, junction diameter)

    • Electron tomography for 3D reconstruction of cristae architecture

    • Immuno-gold labeling to localize OPA1 within cristae structures

  • Biochemical approaches:

    • Subcellular fractionation to isolate mitochondria and analyze cristae-associated protein complexes

    • Crosslinking studies to capture OPA1 interactions with MICOS components

    • Co-immunoprecipitation with MIC60, MIC19, and other MICOS proteins

    • Protease protection assays to assess topology and organization of cristae compartments

  • Liposome-based reconstitution:

    • Preparation of giant unilamellar vesicles (GUVs) with defined lipid composition

    • Addition of purified chicken OPA1 and observation of membrane remodeling

    • Fluorescence microscopy or cryo-EM to visualize membrane deformations

  • Functional correlates:

    • Measurement of respiratory complex assembly and activity

    • Assessment of mitochondrial membrane potential maintenance

    • Evaluation of apoptotic sensitivity (cytochrome c release assays)

    • Analysis of ATP synthesis capacity

Research has shown that OPA1's cristae maintenance function can be partially uncoupled from its fusion activity. For instance, depletion of PGS1, which is involved in cardiolipin synthesis, can restore mitochondrial morphology and respiration in OPA1-deficient cells without rescuing cristae dysmorphology . This suggests that distinct molecular mechanisms govern these two functions of OPA1.

What strategies can overcome challenges in studying chicken OPA1 interactions with other mitochondrial proteins?

Studying protein-protein interactions involving membrane proteins like OPA1 presents significant technical challenges. Effective strategies include:

  • Crosslinking approaches:

    • Chemical crosslinkers with various spacer lengths to capture transient interactions

    • Photo-activatable amino acid incorporation for site-specific crosslinking

    • Mass spectrometry analysis of crosslinked peptides for interaction mapping

  • Split-reporter systems:

    • BiFC (Bimolecular Fluorescence Complementation) for visualizing interactions in living cells

    • Split-luciferase assays for quantitative measurement of interaction dynamics

    • FRET/BRET-based approaches for detecting proximity in real-time

  • Membrane-based co-immunoprecipitation:

    • Gentle solubilization using digitonin or mild detergents like DDM or LMNG

    • GraFix method (gradient fixation) to stabilize large complexes

    • Quantitative mass spectrometry (SILAC, TMT) to distinguish specific interactors

  • Recombinant protein approaches:

    • Co-expression of interaction partners in insect cells

    • Creation of minimal domains for soluble protein interaction studies

    • Surface plasmon resonance or isothermal titration calorimetry for binding kinetics

Known interaction partners to investigate include components of the MICOS complex (MIC60, MIC19), fusion machinery (MFN1/2), and fission proteins (DRP1, MFF) . Recent research has shown that OPA1 interacts with the multisubunit MICOS complex to help mediate cristae organization in addition to remodeling the inner membrane .

Studies in human cells have revealed that OPA1 mutants show altered levels of interaction partners - for example, GED mutants showed significantly increased MFN2 protein levels, while MIC60 levels were decreased in most OPA1 mutants . These findings provide a framework for investigating similar interactions with chicken OPA1.

How can chicken OPA1 be used to model human Dominant Optic Atrophy (ADOA) and inform therapeutic development?

Chicken OPA1 offers valuable opportunities for modeling human Dominant Optic Atrophy (ADOA) due to the conserved structure and function between avian and mammalian OPA1. Strategic approaches include:

  • Comparative mutation analysis:

    • Generate chicken OPA1 constructs with mutations corresponding to human ADOA-causing variants

    • Assess domain-specific effects by introducing mutations in GTPase domain (associated with more severe multisystemic symptoms) versus GED domain

    • Compare biochemical properties and cellular effects of these mutations

  • Cell-based disease modeling:

    • Establish stable cell lines expressing mutant chicken OPA1 variants

    • Evaluate mitochondrial network morphology, respiratory function, cristae structure, and apoptotic sensitivity

    • High-throughput screening platforms for identifying suppressors of mitochondrial fragmentation

  • Structure-function relationship insights:

    • Use recombinant chicken OPA1 for structural studies that inform mechanism of disease mutations

    • Crystallography or cryo-EM analysis of wild-type and mutant proteins

    • Computer-aided drug design targeting specific functional domains

Experimental data from human ADOA patient fibroblasts has shown that certain genetic modifiers can suppress mitochondrial fragmentation. For example, depletion of PGS1 (involved in cardiolipin synthesis) rescues mitochondrial morphology and respiration in OPA1-deficient cells, though it does not restore cristae dysmorphology, apoptotic sensitivity, or mtDNA content . Similar approaches could be applied using chicken OPA1 as a model system.

These findings suggest potential therapeutic strategies focused on rebalancing mitochondrial dynamics rather than directly replacing or augmenting OPA1 function. The chicken OPA1 system provides an excellent platform for testing such approaches before advancing to mammalian models .

What technical considerations are important when using chicken OPA1 to study mitochondrial stress responses?

OPA1 serves as a key sensor and mediator of mitochondrial stress responses, making chicken OPA1 valuable for studying these pathways. Key technical considerations include:

  • Stress induction protocols:

    • Standardize methods for inducing specific stresses:

      • CCCP (10 μM, 1-4 hours) for membrane potential disruption

      • Oligomycin (2-5 μM) for ATP synthase inhibition

      • Valinomycin (1 μM) for K+ ionophore-mediated stress

      • Hydrogen peroxide (100-500 μM) for oxidative stress

    • Include appropriate vehicle controls and time-course analyses

  • OPA1 processing analysis:

    • High-resolution western blotting to resolve multiple OPA1 isoforms

    • Use of antibodies recognizing different OPA1 epitopes to track specific fragments

    • Quantitative densitometry for L-OPA1/S-OPA1 ratio determination

    • Genetic manipulation of processing proteases (OMA1, YME1L) to dissect pathways

  • Stress response pathway integration:

    • Monitor activation of the integrated stress response (ISR) markers (DELE1, HRI, phospho-EIF2α)

    • Assess unfolded protein response activation

    • Evaluate mitochondrial autophagy induction

    • Measure apoptotic sensitivity through cytochrome c release and caspase activation

  • Temporal dynamics consideration:

    • Implement time-course experiments to distinguish early vs. late responses

    • Use live-cell imaging with fluorescent reporters to track real-time changes

    • Apply reversible stressors to study recovery dynamics

Recent findings indicate that OMA1 activation by mitochondrial stress triggers OPA1 processing at the S1 site, while YME1L constitutively cleaves OPA1 at the S2 site. This stress-responsive processing converts fusion-active L-OPA1 to fusion-inactive S-OPA1, promoting mitochondrial fragmentation as a protective response . Importantly, localized fluctuations in membrane potential ("flickering") can trigger OMA1 activation as a protective stress response, demonstrating a highly sensitive, responsive mechanism .

What biophysical methods are most informative for characterizing the structure-function relationship of chicken OPA1?

Understanding the structure-function relationship of chicken OPA1 requires sophisticated biophysical approaches:

  • Structural analysis techniques:

    • X-ray crystallography: Challenging for full-length OPA1 but valuable for individual domains

    • Cryo-electron microscopy: Increasingly important for membrane protein structural studies

    • Small-angle X-ray scattering (SAXS): Provides low-resolution structural information in solution

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps conformational dynamics and ligand-binding regions

  • Conformational dynamics analysis:

    • Single-molecule FRET to detect conformational changes upon GTP binding/hydrolysis

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

    • Nuclear magnetic resonance (NMR) for studying flexible regions and ligand interactions

    • Differential scanning fluorimetry to assess thermal stability and ligand effects

  • Oligomerization and self-assembly studies:

    • Analytical ultracentrifugation to determine oligomeric states

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

    • Native mass spectrometry for intact complex analysis

    • Negative-stain electron microscopy for visualizing assembled structures

Recent structural studies on yeast Mgm1 (OPA1 homolog) have provided valuable insights that can guide research on chicken OPA1. These studies revealed how OPA1 remodels the inner membrane to mediate fusion through a mechanism involving membrane binding, oligomerization, and GTP-dependent conformational changes . Similar approaches with chicken OPA1 could elucidate conserved and divergent aspects of this mechanism.

How can advanced imaging techniques be optimized for studying chicken OPA1 function in cellular contexts?

Advanced imaging approaches provide crucial insights into OPA1 function in cellular contexts:

  • Super-resolution microscopy optimization:

    • STED (Stimulated Emission Depletion) microscopy: Requires careful selection of fluorophores with appropriate photostability

    • PALM/STORM: Utilizes photoactivatable/photoswitchable fluorescent proteins or dyes for single-molecule localization

    • SIM (Structured Illumination Microscopy): Provides ~100 nm resolution suitable for mitochondrial substructures

    • Optimal sample preparation: Fixation protocols that preserve mitochondrial ultrastructure (4% PFA with 0.1% glutaraldehyde)

  • Live-cell imaging considerations:

    • Photobleaching techniques (FRAP, FLIP) to study dynamics of OPA1 mobility

    • Biosensors for monitoring GTPase activity in living cells

    • Dual-color labeling strategies to simultaneously visualize OPA1 and interacting partners

    • Mitochondrial membrane potential sensors to correlate with OPA1 processing events

  • Correlative light and electron microscopy (CLEM):

    • Enables integration of fluorescence data with ultrastructural information

    • Critical for linking OPA1 localization with cristae morphology

    • Requires specialized sample preparation and correlation workflows

  • Image analysis and quantification approaches:

    • Machine learning algorithms for automated detection of mitochondrial morphology changes

    • 3D reconstruction and morphometric analysis of mitochondrial networks

    • Measurement of cristae parameters (width, junction diameter, density)

    • Colocalization analysis with MICOS components and other mitochondrial proteins

Automated imaging methods have been successfully employed to screen for genetic modifiers of mitochondrial fragmentation in OPA1-deficient cells, identifying new genes not previously linked to Dominant Optic Atrophy . These approaches can be readily adapted for studies with chicken OPA1.

What emerging research directions are most promising for advancing our understanding of chicken OPA1 biology?

Several emerging research directions hold significant promise for advancing our understanding of chicken OPA1 biology:

  • Integrative structural biology approaches:

    • Combining cryo-EM, crystallography, and computational modeling to develop comprehensive structural models

    • Single-particle analysis of OPA1 in different nucleotide-bound states

    • Membrane-protein structure determination in native-like lipid environments

  • Systems biology of OPA1 regulation:

    • Multi-omics approaches to understand transcriptional, translational, and post-translational regulation

    • Network analysis of OPA1's role in coordinating mitochondrial stress responses

    • Quantitative modeling of the dynamics between fusion and fission processes

  • Cross-species comparative studies:

    • Systematic comparison of chicken, human, mouse, and yeast OPA1/Mgm1 to identify conserved mechanisms

    • Investigation of species-specific adaptations in OPA1 function

    • Exploring evolutionary conservation of stress-responsive processing

  • Novel therapeutic approaches based on OPA1 biology:

    • Small molecule modulators of OPA1 processing or function

    • Genetic approaches to enhance or modify OPA1 activity

    • Exploitation of genetic modifiers (such as PGS1) identified in suppressor screens

Recent discoveries about OPA1's interactions with cardiolipin and the MICOS complex, as well as its role in stress sensing and apoptotic regulation, provide rich ground for further investigation . Particularly intriguing is the finding that mitochondrial morphology defects can be functionally uncoupled from other pleiotropic effects of OPA1 loss, suggesting targeted therapeutic approaches might address specific aspects of OPA1-related disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.