Recombinant Chicken E3 ubiquitin-protein ligase RNF152 (RNF152)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us for preferential development.
Synonyms
RNF152; E3 ubiquitin-protein ligase RNF152; RING finger protein 152; RING-type E3 ubiquitin transferase RNF152
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDLRCPWCRGITKL PPGYSVSQLPDDPEVIAVIAIPHTSEHTPVFIKLPSNGCYMLPLPLSKERAMLPGDIGCR LLPGSQQKSLAVVTIPAEQQPLQGGLPAEAGAEEPDRRGVVKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG
Uniprot No.

Target Background

Function
RNF152 is a E3 ubiquitin-protein ligase that mediates Lys-63-linked polyubiquitination of RRAGA in response to amino acid starvation, thus regulating mTORC1 signaling and cellular response to amino acid availability. It also mediates Lys-48-linked polyubiquitination of target proteins, leading to proteasomal degradation.
Database Links

KEGG: gga:420909

UniGene: Gga.16814

Protein Families
RNF152 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein.

Q&A

What are the key functional domains of RNF152 and their roles in ubiquitination?

RNF152 contains several critical domains:

  • RING-finger domain: Located at the N-terminus, this cysteine-rich region coordinates zinc ions and is essential for its E3 ligase activity, facilitating the transfer of ubiquitin from E2 enzymes to substrates

  • Transmembrane domain: Anchors RNF152 to lysosomal membranes, positioning it to regulate the mTOR pathway components

  • Cytosolic domain: Mediates interactions with substrate proteins, particularly RagA GTPase

These domains work together to enable RNF152 to catalyze both K48-linked polyubiquitination (targeting proteins for proteasomal degradation) and K63-linked polyubiquitination (involved in signaling pathways) .

How does chicken RNF152 function biochemically as an E3 ubiquitin ligase?

RNF152 functions within the canonical ubiquitination cascade:

  • E1 (ubiquitin-activating enzyme) activates ubiquitin in an ATP-dependent manner

  • E2 (ubiquitin-conjugating enzyme, such as UbcH5c/UBE2D3) receives the activated ubiquitin

  • RNF152 (E3 ligase) recruits both the E2~ubiquitin complex and substrate proteins

  • RNF152 facilitates the transfer of ubiquitin from E2 to specific lysine residues on target proteins

Specifically, RNF152 mediates 'Lys-63'-linked polyubiquitination of RagA in response to amino acid starvation, thereby regulating mTORC1 signaling. It also mediates 'Lys-48'-linked polyubiquitination of various target proteins, marking them for proteasomal degradation .

What are the optimal conditions for producing recombinant RNF152?

Based on production protocols from multiple sources, optimal conditions include:

ParameterRecommended ConditionNotes
Expression SystemE. coli (in vitro)For full-length protein
Purification TagN-terminal 10xHis-tagFacilitates purification without affecting activity
Storage-20°C (short-term) or -80°C (long-term)Avoid repeated freeze-thaw cycles
Working Temperature4°CFor reconstitution and experiments
Buffer Composition50 mM Tris (pH 8.0), 15 mM NaClFor ubiquitination assays

For optimal activity, recombinant RNF152 should be stored in working aliquots at 4°C for up to one week, with longer storage at -20°C or -80°C. Repeated freezing and thawing significantly reduces enzymatic activity .

What experimental systems are most effective for studying RNF152 function?

Several experimental models have proven effective for RNF152 functional studies:

  • In vitro biochemical systems: Using purified components for ubiquitination assays with recombinant RNF152, E1, E2, and substrates to directly assess catalytic activity

  • Cell-free expression systems: Particularly useful for producing transmembrane proteins like RNF152 while maintaining proper folding

  • Zebrafish embryo model: Allows for:

    • Overexpression studies through mRNA injection at 1-2 cell stage

    • Knockdown via morpholino antisense oligonucleotides

    • Whole-mount in situ hybridization (WISH) for expression pattern analysis

    • Analysis of phenotypic effects on midbrain-hindbrain boundary (MHB), rhombomeres, and eye development

  • Chick neural explants: Effective for studying RNF152's role in floor plate (FP) development and mTOR signaling

How can RNF152 activity be measured in vitro?

Multiple methodologies can assess RNF152 ubiquitination activity:

  • Western blot-based ubiquitination assays:

    • Components: Recombinant RNF152, E1 (Ube1), E2 (UbcH5c/UBE2D3), ubiquitin, substrate (e.g., RagA), ATP, and MgCl₂

    • Buffer: 50 mM Tris pH 8.0, 15 mM NaCl

    • Detection: Anti-ubiquitin antibodies or substrate-specific antibodies

    • Controls: Reactions lacking ATP, E1, E2, or using catalytically inactive RNF152 mutants

  • Fluorescence-based assays:

    • Using fluorescently labeled ubiquitin to monitor transfer kinetics

    • FRET-based approaches to study real-time ubiquitination

  • Autoubiquitination assessment:

    • Monitoring RNF152 self-ubiquitination as a measure of catalytic activity

    • Particularly useful for initial activity confirmation and inhibitor screening

  • Substrate-specific assays:

    • For RagA: Monitoring K63-linked ubiquitination in response to amino acid starvation conditions

    • For other substrates: Tailored assays depending on the biological context

What is the expression pattern of RNF152 during embryonic development?

RNF152 exhibits specific spatiotemporal expression patterns during embryogenesis:

In zebrafish:

  • Maternally and zygotically expressed at early embryonic stages

  • At 48 hours post fertilization (hpf), expression is concentrated in:

    • Midbrain-hindbrain boundary (MHB)

    • Rhombomeres (r1-7)

    • Eyes

  • Not detected at HH stage 11 in neural development

  • Expression becomes localized to the floor plate (FP) by HH stages 16 and 22

  • Lower levels of expression observed in the apical region of the neural tube

RT-PCR analysis confirmed the expression of RNF152 (235 bp specific template) across multiple developmental stages, with β-actin (500 bp) serving as an internal control .

What phenotypes result from RNF152 manipulation during embryonic development?

Manipulation of RNF152 levels produces distinct developmental phenotypes:

Overexpression effects (injection of 200 pg capped mRNA in 1-2 cell stage embryos):

  • Indistinctive midbrain-hindbrain boundary (MHB)

  • Diminished hindbrain (rhombomeres r1-7)

  • Smaller eye diameter

  • Reduced neural tube width

Knockdown effects (morpholino antisense oligonucleotides):

  • Significantly smaller eye diameter

  • Undistinguishable MHB

  • Reduced size of rhombomeres (r1-7)

  • Decreased neural tube width

  • Aberrant cell division in the floor plate (abnormal pHH3 expression)

Quantitative measurements showed statistically significant differences in eye diameter and neural tube width between experimental groups and controls .

How does RNF152 interact with neural development pathways?

RNF152 functions within a complex regulatory network during neural development:

  • As a target gene of FoxA2:

    • FoxA2, a transcription factor expressed in the floor plate, induces RNF152 expression

    • The regulatory region of the RNF152 gene contains a FoxA2 binding region

    • RT-qPCR analysis shows significantly higher RNF152 transcription in FoxA2-overexpressing neural explants

  • As a regulator of Delta-Notch signaling:

    • Molecular marker studies using neuroD, deltaD, notch1a, and notch3 show that RNF152 functions as an upstream regulator of Delta-Notch signaling

    • This regulation impacts neurogenesis during embryonic development

  • As a negative regulator of mTOR signaling:

    • RNF152 negatively regulates cell proliferation by blocking mTOR signaling upstream of RagA

    • This explains the selective low proliferation rate of floor plate cells despite high Shh exposure

    • Immunohistochemistry for p-p70S6K confirms downregulation of mTOR signaling in cells overexpressing RNF152

How does RNF152 regulate the mTOR signaling pathway?

RNF152 is a critical negative regulator of mTOR signaling:

  • Mechanism of action:

    • RNF152 targets the GDP-bound form of RagA GTPase for K63-linked ubiquitination

    • This ubiquitination activates GATOR1 (a GAP complex for Rag GTPase), RagA's inhibitor

    • Consequently, mTORC1 signaling is inactivated

    • Immunohistochemistry confirms downregulation of phospho-p70S6K (p-p70S6K), a key mTOR effector, in RNF152-overexpressing cells

  • Functional consequence:

    • Decreased mTOR signaling reduces cell proliferation

    • This explains why floor plate cells exposed to high levels of Shh maintain low proliferation rates

    • Co-electroporation of constitutively-active RagA (CA-RagA) with RNF152 rescues p-p70S6K and pHH3 levels, confirming RagA functions downstream of RNF152

  • Regulation:

    • RNF152 expression is induced by FoxA2, a transcription factor expressed in the floor plate

    • This creates a regulatory circuit: Shh → FoxA2 → RNF152 → ↓mTOR → ↓Proliferation

What is the functional relationship between RNF152 and its substrate RagA?

The RNF152-RagA interaction represents a critical regulatory mechanism:

  • Biochemical interaction:

    • RNF152 specifically ubiquitinates the GDP-bound (inactive) form of RagA

    • This involves K63-linked polyubiquitination, which is primarily involved in signaling rather than degradation

    • The ubiquitination occurs in response to amino acid starvation

  • Functional antagonism:

    • Constitutively-active RagA (CA-RagA) counteracts RNF152's inhibitory effects

    • RagA overexpression restores cell proliferation (pHH3 expression) in RNF152-overexpressing cells

    • Similarly, phospho-p70S6K levels are rescued by CA-RagA co-expression

    • This confirms that RagA functions downstream of RNF152 in controlling cell proliferation

  • Experimental evidence:

    • Loss-of-function experiments (si-RNF152) induce aberrant phospho-S6 expression in the floor plate

    • This demonstrates that mTOR signaling can be reverted by inhibiting RNF152

    • Additionally, pHH3-positive cells appear in the midline (floor plate) following RNF152 knockdown

How does RNF152 contribute to neurodevelopmental patterning?

RNF152 plays multiple roles in neural patterning:

  • Regulation of NeuroD expression:

    • RNF152 is essential for proper NeuroD expression

    • NeuroD is a critical transcription factor in neurogenesis

    • This suggests RNF152 may regulate the transition from neural progenitors to differentiated neurons

  • Modulation of Delta-Notch signaling:

    • Molecular marker studies show RNF152 functions as an upstream regulator of Delta-Notch signaling

    • Expression of deltaD, notch1a, and notch3 is affected by RNF152 manipulation

    • The Delta-Notch pathway is crucial for neuronal fate determination and boundary formation

  • Regional specification:

    • RNF152 is required for proper development of:

      • Midbrain-hindbrain boundary (MHB)

      • Rhombomere development (r1-7)

      • Eye formation

    • Both overexpression and knockdown disrupt these structures, suggesting RNF152 levels must be precisely regulated

What are the current challenges in developing tools to study RNF152 function?

Researchers face several challenges when studying RNF152:

  • Protein stability and storage issues:

    • As a transmembrane protein, RNF152 presents challenges for long-term storage

    • Shelf life is limited to approximately 6 months at -20°C/-80°C in liquid form or 12 months in lyophilized form

    • Repeated freeze-thaw cycles significantly reduce activity

  • Functional redundancy:

    • While RNF152 knockout cells exhibit hyperactivation of mTOR signaling, RNF152 knockout mice are viable

    • This suggests compensatory mechanisms exist, complicating loss-of-function studies

    • Conditional knockout approaches may be necessary to reveal tissue-specific roles

  • Assay development challenges:

    • Direct assessment of E3 ligase activity requires complex multi-component reactions

    • Selecting appropriate substrates for different biological contexts

    • Distinguishing between K48-linked versus K63-linked ubiquitination requires specialized reagents and methods

    • Developing high-throughput assays for inhibitor screening

How can researchers distinguish between the different ubiquitination patterns mediated by RNF152?

Distinguishing between K48-linked and K63-linked ubiquitination requires specialized approaches:

  • Linkage-specific antibodies:

    • Commercial antibodies recognize specifically K48-linked or K63-linked ubiquitin chains

    • Western blotting with these antibodies can determine the type of linkage

  • Mass spectrometry-based approaches:

    • Tryptic digestion of ubiquitinated proteins creates signature peptides at branch points

    • Quantitative analysis can determine the abundance of different linkage types

    • This provides the most definitive evidence of linkage specificity

  • Functional readouts:

    • K48-linked chains primarily lead to proteasomal degradation (monitor substrate stability)

    • K63-linked chains typically mediate signaling (monitor pathway activation)

    • For RNF152 specifically:

      • Monitor RagA protein levels to assess K48 linkage

      • Monitor mTOR pathway activity (p-p70S6K, p-S6) to assess K63-linked signaling effects

What potential applications exist for modulating RNF152 activity in research or therapeutic contexts?

RNF152 modulation offers several promising applications:

  • Developmental biology research:

    • Controlled manipulation of RNF152 levels could provide insights into neural patterning mechanisms

    • Temporal regulation of mTOR signaling during critical developmental windows

    • Understanding compensatory mechanisms in RNF152-deficient systems

  • Cancer research applications:

    • Since mTOR hyperactivation is common in many cancers, RNF152 activation might suppress mTOR-driven tumor growth

    • Similar to other E3 ligases like CHIP, RNF152 modulators could be developed as potential therapeutic tools

    • Antibody-based approaches (similar to those developed for CHIP) could be adapted for RNF152

  • Tool development:

    • Creation of recombinant antibodies targeting specific domains of RNF152

    • Development of small molecule modulators of RNF152 activity

    • Engineered variants with altered substrate specificity or catalytic activity

    • CRISPR-based approaches for conditional regulation of RNF152 expression in specific tissues

What are common issues when working with recombinant RNF152 and how can they be addressed?

Researchers frequently encounter these challenges with RNF152:

IssuePossible CausesSolutions
Low catalytic activityProtein denaturation, improper foldingUse fresh preparations, optimize buffer conditions
Poor substrate ubiquitinationInactive E1/E2 enzymes, insufficient ATPInclude positive controls, ensure ATP regeneration
Non-specific ubiquitinationExcessive incubation time, high enzyme concentrationsOptimize reaction time, titrate enzyme concentrations
Inconsistent resultsBatch-to-batch variation, protein aggregationEstablish quality control metrics, use consistent production methods
Storage-related activity lossFreeze-thaw cycles, improper temperaturePrepare single-use aliquots, maintain consistent storage conditions

Quality control metrics should include:

  • SDS-PAGE to confirm purity and integrity

  • Autoubiquitination assays to confirm catalytic activity

  • Substrate binding assays to verify interaction capacity

  • Mass spectrometry to confirm proper post-translational modifications

How can researchers validate the specificity of RNF152's activity in their experimental systems?

To ensure RNF152 specificity, implement these validation approaches:

  • Control reactions:

    • Catalytically inactive RNF152 mutants (RING domain mutations)

    • Reactions lacking ATP, E1, or E2 enzymes

    • Competition assays with known RNF152 substrates

  • Substrate validation:

    • Mutation of putative ubiquitination sites on substrates

    • Co-immunoprecipitation to confirm direct RNF152-substrate interaction

    • In vitro binding assays with recombinant proteins

  • Functional readouts:

    • For RagA: Monitor mTOR pathway inhibition (reduced p-p70S6K and p-S6)

    • For developmental studies: Analyze eye size, MHB formation, and rhombomere patterning

    • Rescue experiments using constitutively active downstream components (e.g., CA-RagA)

  • Comparative analysis:

    • Parallel experiments with related E3 ligases

    • Domain swapping to identify specificity determinants

    • Cross-species comparisons to identify conserved functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.