Recombinant Chicken Elongation of very long chain fatty acids protein 6 (ELOVL6)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

Recombinant Chicken ELOVL6 is produced in E. coli via bacterial expression systems. Critical production and storage details include:

ParameterDetails
Expression SystemIn vitro E. coli expression system
Storage-20°C or -80°C (long-term); 4°C for short-term working aliquots
Product CodeCSB-CF726504CH (Cusabio)
Purity>95% (typically confirmed via SDS-PAGE and Western blotting)
SequenceMNMSVLTLQEYEFEKQFNEHEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLSLAVFSIFGAVRTAPYMLYILMTKGLKQSVCDQSFYIGPVSKFWAYAFVLSK...

This recombinant protein is widely used in biochemical assays, lipidomics studies, and therapeutic research .

Regulatory Mechanisms and Lipid Metabolism

ELOVL6 activity is tightly regulated by microRNAs and hormones. Key findings include:

MicroRNA Regulation

The chicken-specific miRNA gga-miR-221-5p directly targets ELOVL6 and SQLE (squalene epoxidase) mRNAs, repressing lipid synthesis. Estrogen abolishes this repression, promoting triglyceride and cholesterol accumulation in chicken liver .

Target GenemiRNA Binding SiteFree Energy (kcal/mol)Effect on Lipid Levels
ELOVL63′UTR (seed region)-25.9↑ Triglycerides (TG), ↑ Cholesterol (TC)
SQLE3′UTR (seed region)-26.6↑ TG, ↑ TC

Dual luciferase assays confirmed these interactions in LMH chicken hepatoma cells .

Hormonal Modulation

Estrogen upregulates ELOVL6 expression via estrogen receptor signaling, counteracting miRNA-mediated repression. Antagonists (e.g., ICI 182,780) reverse this effect, reducing lipid synthesis .

Cancer Metabolism

ELOVL6 is implicated in pancreatic ductal adenocarcinoma (PDAC) progression. Its inhibition reduces cell proliferation, induces G1 arrest, and enhances chemotherapy uptake (e.g., Abraxane) by altering membrane permeability .

Cell LineTreatmentEffect on ProliferationMembrane Permeability
T3M4ELOVL6-IN-2↓ 40–60%↑ (Flutax-2 uptake)
Patu 8988TELOVL6 shRNA↓ 50–70%↑ (Wound healing delay)

RNA-seq data revealed downregulation of "myc targets" and "cell cycle" pathways upon ELOVL6 inhibition .

Genetic and Agricultural Implications

Polymorphisms in ELOVL6 correlate with fat deposition in chicken populations. A synonymous SNP (rs14092745) in DDT (D-dopachrome tautomerase) and an intronic SNP (rs16418687) in ELOVL6 associate with subcutaneous fat thickness and fat bandwidth .

SNPGeneTraitp-valueEffect
rs16418687ELOVL6Subcutaneous fat thickness0.033*AA (4.05 mm) vs GG (1.82 mm)
rs14092745DDTFat bandwidth0.048*AA (27.04 mm) vs GG (11.55 mm)

These findings highlight ELOVL6’s potential as a marker for selective breeding in poultry .

Dermatological and Barrier Function

In atopic dermatitis (AD), ELOVL6 deficiency impairs ceramide synthesis, leading to skin barrier dysfunction. It elongates C16:0 to C18:0/C18:1, precursors for very long-chain ceramides (C24/C26) critical for skin hydration and protection .

Ceramide TypeRole in SkinImpact of ELOVL6 Deficiency
C24/C26 CeramidesStructural barrier integrity↓ Levels, ↑ Trans-Epidermal Water Loss (TEWL)
C16 CeramidesPro-inflammatory signaling↑ Levels, ↑ Skin Inflammation

Linoleic acid supplementation may stabilize ELOVL6 activity, mitigating AD severity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ELOVL6; RCJMB04_16d24; Elongation of very long chain fatty acids protein 6; 3-keto acyl-CoA synthase ELOVL6; ELOVL fatty acid elongase 6; ELOVL FA elongase 6; Very long chain 3-ketoacyl-CoA synthase 6; Very long chain 3-oxoacyl-CoA synthase 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
ELOVL6
Target Protein Sequence
MNMSVLTLQEYEFEKQFNEHEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR KPLVLWSLSLAVFSIFGAVRTAPYMLYILMTKGLKQSVCDQSFYIGPVSKFWAYAFVLSK APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY YALRAAGFRVSRKFAMFITLSQITQMLVGCVINYLVFSWMQHGQCHSHVQNIIWSSLMYL SYFVLFCHFFFEAYIGKTTKARKVD
Uniprot No.

Target Background

Function

This recombinant Chicken Elongation of very long chain fatty acids protein 6 (ELOVL6) catalyzes the rate-limiting first step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme adds two carbons per cycle to long- and very long-chain fatty acids (VLCFAs). It exhibits higher activity towards C16:0 acyl-CoAs, elongating fatty acids with 12, 14, and 16 carbons. ELOVL6 also catalyzes the synthesis of unsaturated C16 long-chain fatty acids and, to a lesser extent, C18:0 and those with low desaturation. It is likely involved in producing saturated and monounsaturated VLCFAs of varying chain lengths, serving as precursors for membrane lipids and lipid mediators.

Database Links
Protein Families
ELO family, ELOVL6 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of ELOVL6 in chicken lipid metabolism?

ELOVL6 catalyzes the first and rate-limiting reaction of the long-chain fatty acids elongation cycle in chickens. This endoplasmic reticulum-bound enzyme specifically elongates saturated and monounsaturated fatty acids with 12, 14, and 16 carbons by adding 2-carbon units per cycle. The enzyme shows higher activity toward C16:0 acyl-CoAs and primarily catalyzes the synthesis of unsaturated C16 long-chain fatty acids and, to a lesser extent, C18:0 fatty acids with low desaturation degrees . ELOVL6 participates in producing saturated and monounsaturated very long-chain fatty acids (VLCFAs) that serve as precursors for membrane lipids and lipid mediators in various biological processes .

How is ELOVL6 expressed across different chicken tissues?

Expression profiling reveals tissue-specific patterns of ELOVL6 in chickens. Studies have examined ELOVL6 expression in multiple tissues including hypothalamus, pituitary, liver, abdominal fat, subcutaneous fat, breast muscle, and other tissues . Research has shown that ELOVL gene expression patterns differ significantly between tissues, with each ELOVL family member showing a distinct expression profile. ELOVL6 expression has been thoroughly examined in abdominal fat, subcutaneous fat, breast muscle, liver, and hypothalamus tissues to understand its role in lipid metabolism across different body systems .

What experimental models are appropriate for studying chicken ELOVL6 function?

When investigating chicken ELOVL6 function, researchers typically employ:

  • In vitro cell culture systems using chicken hepatocytes or adipocytes

  • Gene interference approaches (shRNA, CRISPR-Cas9) for functional studies

  • Comparative studies between different chicken breeds with varying fat deposition characteristics

  • Chicken embryo models for developmental studies

For instance, research comparing Recessive White Rock (WRR) and Xinhua (XH) chickens has provided valuable insights into ELOVL6 expression differences and their association with fat deposition traits . Experimental models should be selected based on the specific aspect of ELOVL6 function being investigated, whether enzymatic activity, gene regulation, or physiological impact.

How do genetic variations in chicken ELOVL6 correlate with lipid deposition phenotypes?

Genetic association analyses have revealed that SNPs in ELOVL genes, including ELOVL6, are associated with body weight, carcass traits, and fat deposition in chickens . The genetic variations in ELOVL genes contribute to breeding selection outcomes in commercial chicken varieties. Researchers have identified specific SNPs in ELOVL6 that associate with intramuscular fat content and abdominal fat deposition .

For example, expression analysis shows that ELOVL6 levels in the liver negatively correlate with intramuscular fat content but positively correlate with liver lipid content . This suggests that increased ELOVL6 expression in the liver potentially enhances liver lipid accumulation and abdominal fat deposition but may not promote intramuscular fat deposition during late growth periods .

What mechanisms regulate ELOVL6 expression in different chicken tissues?

ELOVL6 expression in chickens is regulated through multiple mechanisms:

  • Hormonal regulation: Estrogen has been shown to regulate ELOVL6 expression in chicken liver and hypothalamus through different pathways .

  • Transcriptional regulation: Promoter regions contain binding sites for lipid metabolism transcription factors. SNPs in these regions, such as those found in other ELOVL family members like ELOVL3 (rs17631638T>C), can significantly affect gene expression .

  • Breed-specific regulation: Expression levels differ between commercial broilers and native chicken breeds, suggesting genetic background influences regulatory mechanisms .

  • Tissue-specific mechanisms: The regulatory pathways controlling ELOVL6 expression vary between tissues, with distinct patterns observed in liver versus adipose tissue or muscle .

Understanding these regulatory mechanisms provides insight into how ELOVL6 expression changes in response to developmental, nutritional, and physiological conditions.

How can chicken ELOVL6 function be manipulated for studying metabolic pathways?

Researchers can manipulate chicken ELOVL6 function through several approaches:

  • Gene silencing techniques: Using shRNAs or CRISPR-Cas9 to create ELOVL6 knockdowns or knockouts, similar to methods demonstrated in pancreatic cancer cells where ELOVL6 interference reduced cell proliferation .

  • Chemical inhibitors: Small molecule inhibitors like ELOVL6-IN-2 can be used to selectively inhibit ELOVL6 activity, as shown in PDAC research .

  • Overexpression systems: Introducing recombinant ELOVL6 constructs allows for gain-of-function studies.

  • Promoter modification: Targeting the promoter region to alter expression levels, similar to studies on the effect of the rs17631638T>C SNP in ELOVL3 .

The effects of these manipulations can be assessed through measuring changes in:

  • Fatty acid profiles (particularly C16:0/C18:0 ratios)

  • Cell membrane composition and permeability

  • Downstream signaling pathways

  • Cell proliferation and metabolic rates

  • Lipid droplet formation in relevant tissues

What are the methodological considerations for producing functional recombinant chicken ELOVL6?

Producing functional recombinant chicken ELOVL6 requires careful attention to several methodological aspects:

  • Expression system selection: Mammalian cell lines (e.g., HEK293, CHO) are often preferred over bacterial systems due to the need for proper post-translational modifications and membrane integration.

  • Construct design considerations:

    • Inclusion of appropriate tags (His, FLAG) for purification and detection

    • Codon optimization for the expression system

    • Consideration of transmembrane domains when designing constructs

  • Verification methods:

    • Activity assays to confirm elongase function using radioactive or fluorescently labeled fatty acid substrates

    • Western blotting for protein expression confirmation

    • Immunofluorescence for proper subcellular localization

  • Purification challenges: As an integral membrane protein, ELOVL6 requires detergent-based extraction methods that maintain protein folding and activity.

  • Activity reconstitution: Establishing in vitro assay systems with appropriate lipid environments and cofactors.

What are the optimal methods for measuring chicken ELOVL6 enzymatic activity?

Measuring ELOVL6 enzymatic activity requires specialized approaches due to its membrane-bound nature and specific substrate requirements:

  • Microsomal fraction preparation:

    • Differential centrifugation to isolate endoplasmic reticulum fractions

    • Careful buffer selection to maintain enzyme stability

  • Activity assay components:

    • Acyl-CoA substrates (particularly C16:0-CoA)

    • Malonyl-CoA as the 2-carbon donor

    • NADPH and appropriate cofactors

    • Detergent concentrations that maintain activity without disruption

  • Detection methods:

    • Radiometric assays using 14C-labeled substrates

    • LC-MS/MS analysis of elongated products

    • GC-MS analysis of fatty acid methyl esters after reaction

  • Controls and validations:

    • Known ELOVL6 inhibitors as negative controls

    • Comparison with commercially available mammalian ELOVL6

    • Substrate specificity confirmation with various fatty acid chain lengths

How can I analyze the effects of ELOVL6 manipulation on chicken lipid profiles?

To comprehensively analyze the effects of ELOVL6 manipulation on chicken lipid profiles:

  • Tissue preparation:

    • Flash-freezing samples in liquid nitrogen

    • Homogenization in appropriate solvents (chloroform:methanol)

    • Separation of lipid classes via solid-phase extraction

  • Analytical techniques:

    • Gas chromatography for fatty acid methyl ester analysis

    • Lipidomics using LC-MS/MS for comprehensive lipid profiling

    • TLC for basic lipid class separation

  • Key parameters to measure:

    • C16:0/C18:0 ratio as direct indicator of ELOVL6 activity

    • Monounsaturated fatty acid levels (C16:1, C18:1)

    • Complex lipid composition (glycerophospholipids, sphingolipids)

  • Data analysis approaches:

    • Multivariate analysis to identify patterns across multiple lipid species

    • Pathway analysis to understand metabolic impacts

    • Correlation analysis with phenotypic traits

For example, research has shown that ELOVL3 expression in chicken pectoralis is positively correlated with 64 glycerophospholipid molecules, most belonging to phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidylglycerol (PG) and phosphatidylinositol (PI) classes, with sn-2 positions containing numerous ω-3 or ω-6 long-chain polyunsaturated fatty acids .

What strategies can be used to investigate ELOVL6 regulation in chicken tissues?

To investigate ELOVL6 regulation in chicken tissues:

  • Promoter analysis approaches:

    • Luciferase reporter assays with full and truncated promoter constructs

    • ChIP-seq to identify transcription factor binding sites

    • EMSA to confirm specific protein-DNA interactions

  • Transcriptional regulation studies:

    • qRT-PCR for expression analysis across tissues and conditions

    • RNA-seq for comprehensive transcriptome analysis

    • Nuclear run-on assays to measure transcription rates

  • Post-transcriptional mechanisms:

    • miRNA target prediction and validation

    • RNA stability assays

    • Alternative splicing analysis

  • Hormonal regulation experiments:

    • In vivo hormone treatments (e.g., estrogen administration)

    • Ex vivo tissue culture with hormone treatments

    • Receptor antagonist studies

For instance, research has demonstrated that estrogen regulates ELOVL gene expression (including ELOVL6) in chicken liver and hypothalamus through different regulatory pathways . Implementing these strategies would help elucidate the complex regulatory mechanisms controlling ELOVL6 expression in different chicken tissues under various physiological conditions.

How should I analyze and interpret the correlation between ELOVL6 expression and fat-related traits in chickens?

When analyzing correlations between ELOVL6 expression and fat-related traits:

  • Statistical approaches:

    • Pearson or Spearman correlation coefficients for continuous variables

    • Multiple regression to account for confounding variables

    • Linear mixed models when dealing with family structures

  • Tissue-specific considerations:

    • Analyze correlations separately for each tissue (liver, adipose, muscle)

    • Consider tissue interactions and systemic effects

  • Interpretation guidelines:

TissuePositive CorrelationNegative CorrelationInterpretation
LiverLiver lipid contentIntramuscular fatHigh liver ELOVL6 may promote liver fat accumulation while reducing muscle fat
AdiposeAbdominal fat weight-ELOVL family genes in adipose tissue may contribute to abdominal fat deposition
Muscle--Tissue-specific effects differ from other ELOVLs (e.g., ELOVL3)
  • Validation approaches:

    • Cross-validation in independent populations

    • Functional studies to confirm causality

    • Integration with known lipid metabolism pathways

For example, studies have found that ELOVL6 expression in the liver negatively correlates with intramuscular fat content but positively correlates with liver lipid content, suggesting tissue-specific roles in lipid distribution .

What are the key considerations when comparing ELOVL6 function across different chicken breeds?

When comparing ELOVL6 function across chicken breeds:

  • Breed selection considerations:

    • Include diverse genetic backgrounds (e.g., layers vs. broilers)

    • Consider breeds with extreme phenotypes (high vs. low fat deposition)

    • Include both commercial and indigenous breeds

  • Genetic variation analysis:

    • Sequence the ELOVL6 coding and regulatory regions

    • Identify breed-specific SNPs and haplotypes

    • Analyze allele frequencies in different populations

  • Expression pattern comparisons:

    • Standardize tissue collection protocols (age, sex, nutritional status)

    • Use reference genes appropriate for the specific tissues

    • Consider developmental timepoints relevant to fat deposition

  • Functional assay standardization:

    • Use identical substrates and assay conditions

    • Include technical and biological replicates

    • Consider environmental factors that might affect results

For instance, research comparing WRR and XH chickens revealed differences in ELOVL6 expression that correlate with their distinct fat deposition patterns . Similarly, allele frequencies of ELOVL family SNPs differ significantly between native/layer breeds and commercial broiler breeds, suggesting evolutionary selection for specific metabolic characteristics .

How can I integrate ELOVL6 research findings with broader lipid metabolism pathways in poultry?

To integrate ELOVL6 research with broader lipid metabolism understanding:

  • Pathway analysis approaches:

    • Gene set enrichment analysis (GSEA) for transcriptomic data

    • Metabolic flux analysis for lipid pathways

    • Network analysis to identify key interaction partners

  • Multi-omics integration strategies:

    • Combine genomics, transcriptomics, and lipidomics data

    • Correlate ELOVL6 genetic variants with lipidome changes

    • Use systems biology approaches to model pathway interactions

  • Comparative analysis with other species:

    • Leverage findings from mouse models where ELOVL6 knockout prevents diet-induced insulin resistance

    • Compare with mammalian ELOVL6 function and regulation

    • Consider evolutionary conservation of lipid metabolism pathways

  • Practical applications:

    • Identify potential breeding targets for improved meat quality

    • Develop nutritional interventions based on ELOVL6 function

    • Consider health implications of altering fatty acid profiles

For example, research has shown that increased ELOVL6 expression in the liver potentially enhances liver lipid accumulation and promotes abdominal fat deposition but may not promote intramuscular fat deposition during late growth periods . This finding helps integrate ELOVL6 function into the broader understanding of lipid distribution between tissues in chickens.

What are common pitfalls when expressing recombinant chicken ELOVL6 and how can they be overcome?

Common pitfalls and solutions when expressing recombinant chicken ELOVL6:

  • Low expression levels:

    • Solution: Optimize codon usage for expression system

    • Solution: Test different promoters and expression vectors

    • Solution: Consider inducible expression systems to reduce toxicity

  • Protein misfolding and aggregation:

    • Solution: Express at lower temperatures (16-30°C)

    • Solution: Use specialized host strains with chaperones

    • Solution: Include folding enhancers in culture media

  • Improper membrane integration:

    • Solution: Verify proper targeting using GFP fusion constructs

    • Solution: Consider using microsomal fraction rather than purified protein

    • Solution: Optimize detergent types and concentrations for extraction

  • Loss of enzymatic activity:

    • Solution: Validate activity immediately after preparation

    • Solution: Test activity in lipid reconstitution systems

    • Solution: Consider tag position and its effect on active site

  • Reproducibility issues:

    • Solution: Standardize preparation protocols

    • Solution: Include positive controls (known active elongases)

    • Solution: Document all parameters that might affect activity

How can contradictory results in ELOVL6 expression studies be reconciled and interpreted?

Approaches to reconcile contradictory ELOVL6 expression results:

  • Methodological differences:

    • Compare RNA isolation methods (tissue preservation, extraction protocols)

    • Evaluate normalization strategies and reference gene selection

    • Consider primer design and specificity verification

  • Biological factors to consider:

    • Age-dependent expression patterns

    • Sex-specific differences in lipid metabolism

    • Nutritional status and feeding regimens

    • Circadian rhythm effects on metabolic gene expression

  • Experimental design considerations:

    • Sample size and statistical power

    • Tissue heterogeneity and microdissection approaches

    • Breed-specific and individual variation

  • Integrated validation approaches:

    • Confirm RNA expression with protein levels

    • Correlate expression with enzymatic activity

    • Use multiple technical approaches (qPCR, RNA-seq, northern blot)

For instance, studies have shown that ELOVL6 expression can vary significantly depending on the chicken breed, tissue type, and developmental stage, which may explain apparently contradictory results from different research groups .

What emerging technologies could advance chicken ELOVL6 research?

Emerging technologies with potential to advance chicken ELOVL6 research:

  • CRISPR-based approaches:

    • Precise genome editing to create knockout/knockin models

    • Base editing for introducing specific mutations

    • CRISPRi/CRISPRa for modulating expression without sequence changes

  • Advanced imaging techniques:

    • Super-resolution microscopy for subcellular localization

    • FRET-based sensors for real-time activity monitoring

    • Label-free imaging of lipid metabolism

  • Single-cell technologies:

    • Single-cell RNA-seq for cell-specific expression patterns

    • Single-cell lipidomics for heterogeneity analysis

    • Spatial transcriptomics for tissue organization insights

  • Computational approaches:

    • Machine learning for predicting regulatory networks

    • Molecular dynamics simulations of enzyme-substrate interactions

    • Systems biology models of lipid metabolism pathways

  • Innovative functional assays:

    • Microfluidic systems for enzyme kinetics

    • Organoid cultures for tissue-specific function

    • In ovo manipulation techniques for developmental studies

How might ELOVL6 research contribute to addressing specific challenges in poultry science?

ELOVL6 research contributions to poultry science challenges:

  • Meat quality improvement:

    • Modulating intramuscular fat content and composition

    • Enhancing nutritional profiles through altered fatty acid ratios

    • Improving meat tenderness and flavor through lipid profile modification

  • Metabolic disorder management:

    • Reducing excessive fat deposition in broilers

    • Mitigating fatty liver syndrome in layers

    • Understanding the role of altered lipid metabolism in metabolic diseases

  • Breeding program applications:

    • Developing markers for marker-assisted selection

    • Identifying genetic variants associated with desirable traits

    • Understanding gene-environment interactions affecting performance

  • Nutritional intervention design:

    • Tailoring diets to complement genetic potential

    • Developing feed additives that interact with ELOVL6 pathways

    • Optimizing dietary fatty acid composition based on ELOVL6 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.