Recombinant Chicken Ephrin-B1 (EFNB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.

Synonyms
EFNB1; Ephrin-B1; CEK5 ligand; CEK5-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-334
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
EFNB1
Target Protein Sequence
KSLEPVSWSAGNPKFMSGKGLVIYPEIGDKLDIICPKAEPSKPYDYYKLYLVKKDQADACSTVMDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKRQQDYFITSTSNGTLDGLENREGGVCQTRSMKIVMKVGQDPNAVIPEQLTTSRPSKEADNTVKIVTQSPRHKVPTVEEPGKPGSVNQNGQETQGPSDGFLSSKVAVFAAIGAGCVIFILIIIFLVVLLIKIRKRHRKHTQQRAAALSLSTLASPKCSGNAGSEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Uniprot No.

Target Background

Function

Ephrin-B1 is a cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases critical for cell migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. It binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling in neighboring cells. Downstream signaling from the receptor is termed 'forward signaling,' while downstream signaling from the ephrin ligand is known as 'reverse signaling'.

Gene References Into Functions
  1. In Japanese Silky embryos, ephrin-B1 expression in ventral areas, including anterior and posterior somites, correlates with the unique migratory pathways of melanoblasts. PMID: 23916864
  2. Ephrin-B1 receptor interactions are implicated in boundary stabilization during feather morphogenesis. PMID: 23319347
  3. Eph/ephrin-mediated inhibitory interactions and N-cadherin-mediated cell-cell adhesion coordinate to shape discrete sympathetic ganglia. PMID: 17108003
Database Links

KEGG: gga:395896

UniGene: Gga.2142

Protein Families
Ephrin family
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is Ephrin-B1 and how does it function in avian systems?

Ephrin-B1 is a transmembrane protein belonging to the ephrin family that serves as a ligand for Eph receptor tyrosine kinases. In chickens, as in mammals, EFNB1 is membrane-bound with a canonical structure including an extracellular receptor-binding domain, a transmembrane domain, and a cytoplasmic tail. EFNB1 functions through both forward signaling (via receptor activation) and reverse signaling (through its own cytoplasmic domain). The protein is widely expressed across many tissue types and is involved in critical developmental processes including axon guidance and cell adhesion . Chicken EFNB1 shows significant homology with mammalian orthologs, making it a valuable model for comparative studies of ephrin signaling mechanisms.

What are the structural characteristics of recombinant chicken EFNB1?

Recombinant chicken EFNB1 typically preserves the key structural domains of the native protein. The human canonical protein is 346 amino acids with a molecular mass of approximately 38 kDa , and chicken EFNB1 has similar properties. The protein contains several conserved regions:

  • An extracellular receptor-binding domain (RBD) that interacts with Eph receptors

  • A transmembrane domain that anchors the protein to the cell membrane

  • A cytoplasmic domain containing sites for phosphorylation and PDZ-domain protein binding

Importantly, EFNB1 undergoes several post-translational modifications that affect its function, including glycosylation at specific asparagine residues, with N-glycosylation at position N139 (human numbering) being particularly critical for its functional repertoire .

How should recombinant chicken EFNB1 be stored and handled to maintain activity?

For optimal stability and activity, recombinant chicken EFNB1 should be stored at -80°C for long-term storage, with working aliquots kept at -20°C to avoid repeated freeze-thaw cycles. When preparing working solutions, reconstitution should be performed in sterile, pH-neutral buffers (typically PBS with 0.1% BSA as a carrier protein). The protein should be handled on ice when thawed, and centrifugation of the vial is recommended before opening to ensure all material is collected at the bottom. When conducting experiments, researchers should be mindful that recombinant EFNB1's activity can be influenced by its glycosylation status , and appropriate positive controls should be included to verify functional activity prior to experimental use.

What are the optimal conditions for using recombinant chicken EFNB1 in cell culture experiments?

When conducting cell culture experiments with recombinant chicken EFNB1, researchers should consider the following:

  • Concentration range: Typically 50-500 ng/mL, depending on the cell type and experimental endpoint

  • Pre-clustering: For some applications, pre-clustering EFNB1 with anti-Fc antibodies at a 1:2 ratio might enhance signaling efficiency

  • Treatment duration: For signaling studies, 5-30 minutes is appropriate; for functional studies (migration, proliferation), 24-72 hours

  • Medium conditions: Serum-free or low-serum (0.5-2%) conditions are recommended during treatment to minimize interference from serum factors

When studying the effects of EFNB1 on cell proliferation or migration, researchers should prepare conditioned media carefully, as demonstrated in studies where EFNB1-expressing fibroblast conditioned media promoted epithelial cell proliferation and migration . Additionally, researchers should be aware that the glycosylation status of EFNB1 significantly impacts its functionality, with glycosylation-deficient variants showing altered cellular responses .

How can I verify the functionality of recombinant chicken EFNB1 before using it in complex experiments?

To verify the functionality of recombinant chicken EFNB1, implement a multi-step validation approach:

  • Biochemical verification: Confirm protein integrity through SDS-PAGE and Western blotting using anti-EFNB1 antibodies .

  • Binding assay: Test binding to recombinant EphB receptors (particularly EphB1, EphB2, or EphB4) using ELISA or surface plasmon resonance. Functional EFNB1 should demonstrate KD values in the nanomolar range.

  • Cell-based functional assay: Use a known EFNB1-responsive cell line to verify activity:

    • Platelet aggregation assay: EFNB1 potentiates platelet aggregation in the presence of other agonists

    • Cell migration assay: EFNB1 enhances epithelial cell migration in wound healing assays

    • Rap1 activation assay: Functional EFNB1 activates Rap1 in platelets or other responsive cells

  • Phosphorylation analysis: While not required for all EFNB1 functions, verify reverse signaling capability by detecting phosphorylation of EFNB1's cytoplasmic domain in response to EphB receptor binding .

When validating glycosylated forms, compare with non-glycosylated variants, as glycosylation within the receptor-binding domain significantly affects function .

What are the most effective methods for detecting chicken EFNB1 expression in tissue samples?

For detecting chicken EFNB1 in tissue samples, researchers should employ multiple complementary techniques:

  • Immunohistochemistry (IHC): Use anti-EFNB1 antibodies with confirmed cross-reactivity to chicken EFNB1 . For formalin-fixed paraffin-embedded tissues, antigen retrieval (citrate buffer, pH 6.0) is recommended. Counterstain with hematoxylin to visualize tissue architecture.

  • Immunofluorescence: Particularly useful for co-localization studies with other proteins. Use fluorophore-conjugated secondary antibodies and DAPI for nuclear counterstaining.

  • Western blotting: For protein level quantification, employ tissue homogenization in RIPA buffer with protease inhibitors. Expected band size for chicken EFNB1 is approximately 38 kDa, though glycosylation can increase apparent molecular weight .

  • RT-qPCR: For mRNA expression analysis, design primers specific to chicken EFNB1 sequence with confirmation of specificity through sequencing of PCR products.

  • RNAscope: For high-sensitivity mRNA detection in tissues with spatial resolution, especially useful for tissues with low expression levels.

When analyzing results, researchers should be aware that EFNB1 expression patterns may vary across different cell types within tissues, with notable expression in stromal components and specific cellular compartments .

How does glycosylation affect the function of recombinant chicken EFNB1 in experimental systems?

Glycosylation critically modulates EFNB1 function through multiple mechanisms:

  • Receptor binding dynamics: N-glycosylation within the receptor-binding domain (RBD) is essential for optimal interaction with Eph receptors. The glycosylation-deficient N139D mutant demonstrates significantly altered functionality compared to wild-type EFNB1 .

  • Signaling pathway activation: Glycosylation status influences downstream signaling cascades. Transcriptomic analysis has revealed that glycosylation modifications primarily modulate immune response and oxidative phosphorylation pathways .

  • Therapeutic susceptibility: Wild-type glycosylated EFNB1 enhances tumor cell sensitivity to chemotherapeutic agents, whereas glycosylation-deficient mutants significantly reduce this sensitivity, indicating glycosylation-dependent and -independent effects .

  • Cell-cell interactions: In co-culture systems, the efficacy of EFNB1-RBD-Fc recombinant proteins on target cells is influenced by their glycosylation status, with differential impacts on stromal versus tumor cells .

When designing experiments with recombinant chicken EFNB1, researchers should consider:

  • Using both glycosylated and non-glycosylated variants to compare functional differences

  • Evaluating endogenous EFNB1 levels in target cells, as this influences response to exogenous EFNB1

  • Including appropriate controls to account for glycosylation-dependent effects

What signaling pathways are activated by recombinant chicken EFNB1 and how can they be monitored?

Recombinant chicken EFNB1 activates multiple signaling pathways that can be monitored using specific techniques:

  • Rap1 Signaling Pathway:

    • EFNB1 promotes Rap1 activation largely independent of secreted ADP

    • This activation appears minimally affected by PI3-kinase or Src family member inhibition

    • Monitor via: Rap1 activation assays (pull-down assays with the RalGDS-RBD domain)

  • PDZ Domain-Mediated Signaling:

    • EFNB1 contains a PDZ target domain that interacts with PDZ domain-containing proteins

    • This interaction occurs independent of tyrosine phosphorylation

    • Monitor via: Co-immunoprecipitation with PDZ domain-containing proteins

  • Integrin Activation Pathway:

    • EFNB1 potentiates integrin activation, particularly αIIbβ3

    • This process is linked to Rap1 activation

    • Monitor via: Soluble fibrinogen binding assays, adhesion assays

  • Stromal Activation Pathways:

    • EFNB1 activates Src family kinases in fibroblasts

    • It promotes VEGF expression and collagen deposition

    • Monitor via: Western blotting for phosphorylated Src, ELISA for VEGF, picrosirius red staining

  • Cell Proliferation/Migration Pathways:

    • EFNB1 enhances epithelial cell proliferation and migration

    • Monitor via: Ki67 staining, wound healing assays, BrdU incorporation

When monitoring these pathways, researchers should implement both acute (minutes to hours) and long-term (24-72 hours) time points to capture the full spectrum of signaling events.

How can recombinant chicken EFNB1 be used to study tumor-stromal interactions in avian cancer models?

Recombinant chicken EFNB1 provides a valuable tool for investigating tumor-stromal interactions in avian cancer models through several experimental approaches:

  • Co-culture systems: Establish co-cultures of chicken tumor cells with stromal fibroblasts treated with recombinant EFNB1 to analyze:

    • Changes in stromal activation markers

    • Alterations in extracellular matrix composition

    • Reciprocal signaling between tumor and stromal components

  • Conditioned media experiments: Generate conditioned media from EFNB1-treated stromal cells to assess:

    • Effects on tumor cell proliferation and migration

    • Alterations in tumor cell gene expression profiles

    • Modulation of tumor cell resistance to therapeutic agents

  • Three-dimensional (3D) organoid models: Incorporate recombinant EFNB1 in 3D organoid cultures containing both tumor and stromal components to evaluate:

    • Spatial organization of tumor-stromal interactions

    • Extracellular matrix deposition and remodeling

    • Tumor cell invasion capacity

  • Recombinant protein variant comparisons: Compare the effects of glycosylated versus non-glycosylated EFNB1 on tumor-stromal interactions, as glycosylation status significantly impacts functional outcomes .

Recent research has demonstrated that EFNB1-expressing fibroblasts show characteristics of cancer-associated fibroblasts (CAFs), with increased VEGF expression and enhanced collagen deposition, supporting tumor progression . This suggests that targeting EFNB1 signaling in the tumor microenvironment could have therapeutic potential.

What are common pitfalls when working with recombinant chicken EFNB1 and how can they be avoided?

When working with recombinant chicken EFNB1, researchers should be aware of these common pitfalls and solutions:

  • Loss of activity during storage/handling:

    • Pitfall: Protein degradation or aggregation

    • Solution: Store at -80°C in small single-use aliquots; avoid repeated freeze-thaw cycles; add carrier protein (0.1% BSA) to dilute solutions

  • Inconsistent functional outcomes:

    • Pitfall: Variable glycosylation status affecting function

    • Solution: Characterize glycosylation status before use; compare results with both glycosylated and non-glycosylated variants ; maintain consistent sources of recombinant protein

  • Poor cell responsiveness:

    • Pitfall: Insufficient expression of compatible Eph receptors on target cells

    • Solution: Verify Eph receptor expression (particularly EphB2 and EphB4) on target cells via flow cytometry or Western blotting before experiments

  • Suboptimal signaling activation:

    • Pitfall: Using monomeric instead of clustered EFNB1

    • Solution: Pre-cluster EFNB1-Fc fusion proteins with anti-Fc antibodies at a 1:2 ratio to enhance signaling efficiency

  • Interference from endogenous EFNB1:

    • Pitfall: Variable responses due to differing endogenous EFNB1 levels

    • Solution: Quantify endogenous EFNB1 expression in experimental cell lines; consider using EFNB1-knockout or knockdown models for cleaner results

  • Non-specific binding in immunodetection:

    • Pitfall: Cross-reactivity with other ephrin family members

    • Solution: Validate antibody specificity using positive and negative controls; consider using multiple antibodies targeting different epitopes

How can I differentiate between forward and reverse signaling effects when using recombinant chicken EFNB1?

Distinguishing between forward and reverse signaling effects of EFNB1 requires strategic experimental design:

  • Use of specialized recombinant proteins:

    • For forward signaling only: Use EFNB1-Fc fusion proteins with truncated cytoplasmic domains

    • For reverse signaling: Use pre-clustered EphB receptor ectodomains fused to Fc

  • Cell-specific experimental design:

    • Forward signaling: Apply soluble EFNB1-Fc to Eph receptor-expressing cells

    • Reverse signaling: Immobilize EphB receptors and observe effects on EFNB1-expressing cells

  • Signaling pathway analysis:

    • Forward signaling markers: Monitor phosphorylation of Eph receptors and downstream targets like Src family kinases

    • Reverse signaling markers: Examine EFNB1 tyrosine phosphorylation and PDZ-domain protein recruitment

  • Genetic modifications:

    • Express mutant EFNB1 lacking cytoplasmic signaling domains to isolate forward signaling effects

    • Use cells expressing kinase-deficient Eph receptors to isolate reverse signaling

  • Pharmacological inhibitors:

    • Use Src family kinase inhibitors (e.g., PP2) which differentially affect forward vs. reverse signaling

    • Apply PI3-kinase inhibitors (e.g., LY294002) to distinguish pathway dependencies

Research has shown that in platelets, EFNB1 reverse signaling can occur independent of tyrosine phosphorylation and appears to utilize PDZ domain-mediated mechanisms, while still activating downstream targets like Rap1 .

How should experiments be designed to account for species-specific differences when using chicken EFNB1 in mammalian systems?

When using chicken EFNB1 in mammalian experimental systems, researchers should implement the following design considerations to account for species-specific differences:

  • Receptor binding compatibility assessment:

    • Perform comparative binding assays between chicken and mammalian EFNB1 with various Eph receptors

    • Quantify binding affinities (KD values) to identify potential differences in receptor preference

    • Consider using receptor blocking antibodies to verify specificity of observed effects

  • Cross-species signaling validation:

    • Compare signaling pathway activation between chicken and mammalian EFNB1

    • Analyze phosphorylation patterns of downstream targets

    • Validate key findings with both chicken and mammalian EFNB1 variants

  • Glycosylation pattern analysis:

    • Characterize N-glycosylation patterns of chicken versus mammalian EFNB1

    • Consider effects of expression system (bacterial, insect, mammalian) on glycosylation

    • Evaluate functional consequences of glycosylation differences

  • Control selection:

    • Include both species-matched and cross-species controls

    • Use mammalian EFNB1 as a parallel control in all experiments

    • Consider using chimeric proteins combining domains from both species to pinpoint functional differences

  • Dose-response adjustments:

    • Perform careful dose-response studies, as potency may differ between species variants

    • Establish equivalent functional concentrations rather than equal mass concentrations

    • Analyze response kinetics to identify potential temporal differences in signaling

EFNB1 is evolutionarily conserved across species including mouse, rat, bovine, frog, zebrafish, chimpanzee, and chicken , but subtle structural differences may impact cross-species applications and should be systematically addressed in experimental design.

How can recombinant chicken EFNB1 be leveraged for therapeutic development in human diseases?

Recombinant chicken EFNB1 offers valuable insights for therapeutic development through several research approaches:

  • Comparative structure-function analysis:

    • Chicken EFNB1 provides evolutionary insights into conserved functional domains

    • Cross-species comparisons help identify critical epitopes for therapeutic targeting

    • Conservation analysis highlights essential vs. dispensable regions for drug design

  • Novel therapeutic modality development:

    • EFNB1-RBD-Fc fusion proteins show potential for inhibiting B-lymphoma cells

    • The effectiveness of these therapeutics is modulated by glycosylation status and endogenous EFNB1 levels

    • Chicken EFNB1 variants can serve as alternative templates for optimizing therapeutic efficacy

  • Tumor microenvironment modulation:

    • EFNB1 influences stromal activation and tumor-stromal interactions

    • Targeting these interactions represents a promising therapeutic avenue

    • Chicken EFNB1 can be used to study evolutionary conservation of these effects

  • Sensitization to conventional therapies:

    • Wild-type EFNB1 enhances tumor cell sensitivity to chemotherapeutic agents

    • This effect is dependent on proper glycosylation

    • Understanding these mechanisms can inform combination therapy approaches

Recent research indicates that glycosylation patterns significantly impact the therapeutic potential of EFNB1-targeted approaches, with properly glycosylated EFNB1 demonstrating superior efficacy in certain contexts . The continued study of chicken EFNB1 alongside human variants will help refine therapeutic strategies by revealing fundamental mechanisms of action.

What emerging technologies can enhance the study of EFNB1 signaling dynamics in avian systems?

Emerging technologies offer powerful new approaches to study EFNB1 signaling dynamics in avian systems:

  • CRISPR-Cas9 genome editing in avian cells and embryos:

    • Generation of EFNB1 knockout or knock-in chicken cell lines

    • Introduction of specific mutations (e.g., glycosylation site mutations)

    • Creation of reporter constructs for real-time signaling visualization

  • Advanced imaging technologies:

    • Live-cell FRET (Förster Resonance Energy Transfer) to visualize EFNB1-Eph receptor interactions

    • Super-resolution microscopy to analyze EFNB1 clustering and membrane organization

    • Light-sheet microscopy for 3D visualization of EFNB1 signaling in tissue contexts

  • Single-cell analysis platforms:

    • Single-cell RNA-seq to profile cell-type specific responses to EFNB1 signaling

    • CyTOF (mass cytometry) for comprehensive phospho-protein signaling analysis

    • Spatial transcriptomics to map EFNB1 signaling effects across tissue microenvironments

  • Optogenetic and chemogenetic tools:

    • Light-controlled activation of EFNB1 signaling for precise temporal control

    • Chemically-induced dimerization systems to trigger EFNB1 clustering

    • These approaches allow for unprecedented control over signaling initiation and termination

  • Organoid and ex vivo culture systems:

    • Chicken embryonic organoids for developmental studies

    • Patient-derived tumor organoids for therapeutic response testing

    • These systems bridge the gap between simplistic cell culture and complex in vivo models

These technologies will help resolve current questions regarding the temporal dynamics of EFNB1 signaling, cell type-specific responses, and the impact of microenvironmental factors on signaling outcomes in both normal and pathological contexts.

How does EFNB1 coordinate with other ephrin family members in developmental and pathological processes?

EFNB1 functions within a complex network of ephrin family members, coordinating various biological processes:

  • Compensatory and synergistic mechanisms:

    • Other B-class ephrins (EFNB2, EFNB3) can partially compensate for EFNB1 in certain contexts

    • EFNB1 may form heteroclusters with other ephrins to create unique signaling platforms

    • Research suggests differential effects of EFNB1, EFNB2, and EFNB3 on promoting epithelial cell proliferation and migration in the tumor microenvironment

  • Receptor binding preferences:

    • EFNB1 preferentially binds to EphB2 and EphB4 receptors

    • Competitive binding between different ephrins for the same receptors creates signaling hierarchies

    • The specific receptor engagement pattern determines downstream signaling outcomes

  • Tissue-specific cooperation:

    • In bone development, EFNB1 overexpression enhances bone mass through mechanisms that may involve coordination with other ephrin family members

    • In platelets, EFNB1 promotes Rap1 activation and integrin engagement through pathways distinct from other signaling molecules

    • In tumor microenvironments, EFNB1 and other B-class ephrins in stromal cells can influence cancer progression through varied mechanisms

  • Pathological implications:

    • Dysregulated coordination between EFNB1 and other ephrins contributes to diseases like Craniofrontonasal syndrome

    • In cancer, the balance between different ephrin family members shapes tumor growth and metastatic potential

    • Therapeutic targeting must consider the compensatory potential of related family members

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.