Recombinant Chicken Epidermal growth factor receptor (EGFR), partial

Shipped with Ice Packs
In Stock

Description

Ligand Binding and Signaling

  • EGF Interaction: The recombinant protein binds chicken EGF with high affinity, facilitating studies on receptor-ligand dynamics. Yeast-derived chicken EGF (96% homologous to quail/turkey variants) is commonly used .

  • In Ovo Studies: Injecting EGF into chicken embryos upregulated EGFR expression by 160–640 μg/kg of egg weight, though no post-hatch growth differences were observed .

Intestinal Stem Cell Regulation

  • RAL GTPase Dependency: In Drosophila models, RAL GTPases regulate EGFR internalization, a mechanism conserved in avian systems. Knockdown of RalA reduced EGFR endocytosis, impairing MAPK signaling .

Comparative Analysis of Expression Systems

ParameterE. coli-Expressed Mammalian-Cell-Expressed
Post-Translational ModificationsLimited (no glycosylation)Native-like (glycosylation possible)
Endotoxin LevelsNot specified<1.0 EU/μg
YieldHigh (bacterial scalability)Lower (complex production)

The E. coli system is cost-effective for large-scale production, while mammalian cells better replicate natural protein folding .

Truncated EGFR Variants and Functional Implications

A 1.8 kb alternative transcript in humans encodes a secreted EGFR variant (ErbB1-S) lacking transmembrane/kinase domains. While not directly observed in chickens, analogous truncations may modulate ligand availability or act as decoy receptors .

Key Research Findings

  • Structural Insights: The extracellular domain (residues 31–703) includes subdomains I–III, critical for EGF binding and dimerization .

  • Storage Stability: Lyophilized protein retains activity for >6 months at -80°C when reconstituted in PBS with 6% trehalose .

  • Cross-Species Relevance: Chicken EGFR shares 88% homology with mammalian EGFR extracellular domains, enabling translational studies .

Future Directions

Current research focuses on optimizing recombinant EGFR for:

  • High-throughput drug screening against avian pathogens.

  • Structural resolution of EGF-EGFR complexes via cryo-EM.

  • Role in developmental biology, particularly intestinal and epithelial maturation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance and expect additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
EGFR; Epidermal growth factor receptor; CER; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-703
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
VEEKKVCQGTNNKLTQLGHVEDHFTSLQRMYNNCEVVLSNLEITYVEHNRDLTFLKTIQE VAGYVLIALNMVDVIPLENLQIIRGNVLYDNSFALAVLSNYHMNKTQGLRELPMKRLSEI LNGGVKISNNPKLCNMDTVLWNDIIDTSRKPLTVLDFASNLSSCPKCHPNCTEDHCWGAG EQNCQTLTKVICAQQCSGRCRGKVPSDCCHNQCAAGCTGPRESDCLACRKFRDDATCKDT CPPLVLYNPTTYQMDVNPEGKYSFGATCVRECPHNYVVTDHGSCVRSCNTDTYEVEENGV RKCKKCDGLCSKVCNGIGIGELKGILSINATNIDSFKNCTKINGDVSILPVAFLGDAFTK TLPLDPKKLDVFRTVKEISGFLLIQAWPDNATDLYAFENLEIIRGRTKQHGQYSLAVVNL KIQSLGLRSLKEISDGDIAIMKNKNLCYADTMNWRSLFATQSQKTKIIQNRNKNDCTADR HVCDPLCSDVGCWGPGPFHCFSCRFFSRQKECVKQCNILQGEPREFERDSKCLPCHSECL VQNSTAYNTTCSGPGPDHCMKCAHFIDGPHCVKACPAGVLGENDTLVWKYADANAVCQLC HPNCTRGCKGPGLEGCPNGSKTPSIAAGVVGGLLCLVVVGLGIGLYLRRRHIVRKRTLRR LLQERELVEPLTP
Uniprot No.

Target Background

Function
Receptor tyrosine kinase binding ligands of the EGF family activate several signaling cascades to translate extracellular cues into appropriate cellular responses. Known ligands include EGF and TGFA/TGF-alpha. Ligand binding triggers receptor homo- and/or heterodimerization, followed by autophosphorylation on key cytoplasmic residues. The phosphorylated receptor then recruits adapter proteins like GRB2, which in turn activates downstream signaling cascades. This protein activates at least four major downstream signaling cascades, including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC, and STATs modules. It may also activate the NF-kappa-B signaling cascade.
Gene References Into Functions
  1. Epidermal growth factor receptor (EGFR) expression was significantly down-regulated after Marek's disease virus infection. The methylation level of the EGFR promoter was significantly increased at 21 days postinfection. PMID: 23901748
  2. Data suggest that a conserved mechanism involving EGFR signaling governs the proliferation of auditory supporting cells in birds and mammals, potentially representing a target for future hair cell regeneration strategies. PMID: 22230616
  3. EGFR signaling potentially plays a role in anterior-posterior and dorsal-ventral patterning, apical ectodermal ridges formation, and cell survival during limb morphogenesis. PMID: 15778992
Database Links
Protein Families
Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Endosome. Endosome membrane. Nucleus.

Q&A

What is the structure and function of chicken EGFR?

Chicken Epidermal Growth Factor Receptor (EGFR) is a receptor tyrosine kinase (RTK) that plays crucial roles in cellular signaling pathways. The receptor contains an extracellular ligand-binding domain, a transmembrane domain, and an intracellular tyrosine kinase domain. When activated by ligands such as EGF, the receptor undergoes dimerization and autophosphorylation, creating binding sites for various signaling molecules containing SH2 domains.

The phosphorylated form of EGFR serves as a docking site for proteins containing SH2 domains, including cellular homologs of viral oncoproteins such as v-Crk. Studies have demonstrated that both full-length Crk and isolated SH2 domains of proteins like GAP or Abl can bind to phosphorylated chicken EGFR with high affinity . This binding protects EGFR from dephosphorylation by cellular phosphatases, thereby potentially prolonging its signaling capacity .

How does chicken EGFR differ from mammalian EGFR?

Chicken EGFR shares significant homology with mammalian EGFR but exhibits some distinct characteristics. While the core functional domains are conserved, chicken EGFR has unique binding affinities and interaction patterns with SH2 domain-containing proteins. In competitive binding assays, both full-length Crk and GAPSH2[N] bind to phosphorylated chicken EGFR with high affinity and can quantitatively compete with each other .

In terms of developmental expression, chicken EGFR has been detected in various embryonic tissues including kidney and heart cells at early stages of development . The presence of EGFR in chicken embryos has made it a valuable model for studying receptor tyrosine kinase functions in development.

What is the physiological role of EGFR in chicken development?

EGFR plays significant roles in chicken embryonic development, being detected in various tissues including kidney and heart cells during early developmental stages . Despite its presence, studies have shown that EGF supplementation (up to 200 ng/ml) does not significantly affect whole-body protein synthesis in chicken embryos cultured in vitro .

What are the optimal methods for expressing recombinant chicken EGFR?

For producing recombinant chicken EGFR, bacterial expression systems using glutathione S-transferase (GST) fusion proteins have been successfully employed. The use of GST-fusion proteins allows for efficient purification and subsequent functional studies . Below is a methodological approach:

  • Cloning: Insert the coding sequence for chicken EGFR (partial or full-length) into appropriate bacterial expression vectors containing GST tags.

  • Expression conditions: Transform the construct into E. coli strains optimized for protein expression, typically grown at reduced temperatures (16-25°C) after induction to enhance proper folding.

  • Purification: Use glutathione-agarose affinity chromatography to purify the GST-EGFR fusion protein.

  • Functional validation: Verify the protein's functionality through binding assays with known interactors or by assessing tyrosine kinase activity.

For researchers requiring properly glycosylated EGFR with native conformation, mammalian expression systems using CHO or HEK293 cells may be more appropriate, though these systems were not specifically described in the search results.

What assays can be used to study binding interactions with recombinant chicken EGFR?

Several robust assays have been developed to study binding interactions with chicken EGFR:

  • In vitro microtiter assay: This allows for quantitative assessment of binding between bacterially expressed GST-fusion proteins (such as v-Crk and c-Crk) and phosphorylated EGFR . The assay can be used to determine relative binding affinities and to conduct competitive binding studies.

  • Competitive enzyme-linked immunosorbent assay (ELISA): This methodology enables researchers to compare the abilities of various SH2 domain-containing proteins to compete for binding to phosphorylated EGFR . The table below summarizes relative binding affinities of different SH2-containing proteins to chicken EGFR:

ProteinRelative Binding AffinityProtection Against Dephosphorylation
Full-length CrkHighSignificant
GAPSH2[N]HighSignificant
AblSH2ModerateSignificant
SrcSH2Moderate to LowLimited
PLC-γ SH2[N]LowLimited
  • Nitrocellulose filter binding assay: This technique has been used to demonstrate high-affinity binding of Crk to denatured p130, a major phosphotyrosine-containing protein in CT10-transformed cells . This assay can reveal binding specificities that may not be apparent in solution-based assays.

How can phosphorylation status of chicken EGFR be monitored?

Monitoring the phosphorylation status of chicken EGFR is crucial for studying its activation and signaling properties. Several approaches can be employed:

When monitoring EGFR phosphorylation in the context of overexpression studies, it's important to control for basal activation levels, as neither EGFR knock-down nor overexpression alone typically induces EGFR or ERK2 phosphorylation in the absence of ligand stimulation .

How does chicken EGFR contribute to viral uptake mechanisms?

Chicken EGFR has been implicated in facilitating viral entry, particularly for influenza A virus (IAV). Research indicates that IAV attachment results in rearrangement of signaling platforms in the plasma membrane, leading to activation of receptor tyrosine kinases including EGFR . The mechanism involves several key steps:

  • Membrane reorganization: Virus attachment triggers redistribution of EGFR into lipid raft domains, as evidenced by co-patching experiments showing more than 70% overlap between EGFR and the lipid raft marker GM1 .

  • Enhanced internalization: Increased EGFR abundance significantly enhances IAV uptake, as demonstrated by higher levels of virion-associated M1 protein in cells overexpressing EGFR . This accelerated virus internalization correlates with increased virus yields.

  • Temporal specificity: EGFR inhibition through blocking antibodies is effective at reducing progeny virus titers only when applied during early stages of infection, suggesting a specific role in viral entry rather than later stages of viral replication .

The table below summarizes experimental approaches to modulate EGFR activity and their effects on IAV internalization:

InterventionEffect on EGFRImpact on IAV UptakeEffect on Virus Titers
EGFR overexpressionIncreased levelsEnhanced internalizationIncreased yields
EGFR-specific siRNAReduced expressionReduced internalizationDecreased titers (~70-75%)
Blocking antibody (early)Inhibited functionReduced internalizationDecreased titers
EGF pre-treatmentEGFR degradationStrongly reduced internalizationSignificantly decreased titers
RTK inhibitor mixInhibited activityReduced internalizationDecreased titers (up to 75%)

These findings suggest that chicken EGFR serves as a co-factor for efficient IAV entry, providing a potential target for antiviral strategies .

How can contradicting data regarding EGFR's role in protein synthesis be reconciled?

The research literature presents some apparently contradictory findings regarding EGFR's role in protein synthesis, particularly in chicken embryos. While EGFR has been implicated in stimulating protein synthesis in cultured epidermal cells, studies using whole chicken embryos found that EGF supplementation (up to 200 ng/ml) did not significantly affect whole-body protein synthesis rates .

Several hypotheses may reconcile these contradictions:

  • Tissue specificity: EGFR may stimulate protein synthesis only in specific cell types (e.g., epidermal cells) rather than having a global effect on whole-body protein synthesis . This tissue-specific response might be diluted when measuring whole-body effects.

  • Developmental timing: The effect of EGFR activation might be dependent on developmental stage. EGF binding to chicken tissues during embryonic development reaches a peak at days 10-12 , suggesting that sensitivity to EGF stimulation varies temporally.

  • Counteracting factors: Chicken embryo extract (CEE) contains not only growth-promoting factors but also growth-suppressing factors that may counteract stimulatory effects . The same may apply to endogenous factors in whole embryos that modulate EGFR signaling.

  • Methodological differences: Studies showing protein synthesis stimulation often use isolated cells or tissues, while negative findings came from whole-embryo studies. The different experimental systems (isolated cells vs. whole organisms) may contribute to the discrepancies.

To resolve these contradictions, researchers should consider experimental designs that:

  • Compare protein synthesis rates in isolated tissues versus whole embryos

  • Examine the effects at different developmental stages

  • Identify potential counteracting factors present in whole embryos

  • Investigate downstream signaling pathway differences between responsive and non-responsive tissues

What are the implications of EGFR-SH2 domain interactions for cancer research?

The interactions between phosphorylated chicken EGFR and SH2 domain-containing proteins have significant implications for cancer research, particularly in understanding oncogenic transformation mechanisms. Studies have shown that both full-length Crk and isolated SH2 domains can protect phosphorylated EGFR against dephosphorylation by cellular phosphatases .

This protection mechanism may contribute to prolonged EGFR signaling in cancer cells, as sustained tyrosine phosphorylation would maintain downstream signaling pathways that promote cell proliferation and survival. The v-Crk oncoprotein, which contains SH2 and SH3 domains, can induce transformation of chicken embryo fibroblasts by influencing cellular proteins involved in growth regulation .

Specific research implications include:

  • Therapeutic targeting: Understanding the specific interactions between EGFR and various SH2 domain-containing proteins could lead to the development of targeted therapies that disrupt these interactions in cancer cells.

  • Biomarker development: The binding specificity of Crk to phosphorylated proteins like p130 suggests potential biomarkers for monitoring oncogenic transformation or response to therapy.

  • Comparative oncology: Chicken EGFR studies provide valuable insights for comparative oncology, as the mechanisms of EGFR signaling in avian systems share similarities with, yet distinct differences from, mammalian systems.

  • Resistance mechanisms: The protection against dephosphorylation conferred by SH2 domain binding may contribute to resistance against tyrosine kinase inhibitors in cancer treatment, suggesting combination strategies that target both kinase activity and protein-protein interactions.

What are common challenges in producing functional recombinant chicken EGFR?

Researchers working with recombinant chicken EGFR face several technical challenges:

  • Protein folding and stability: Ensuring proper folding of the recombinant protein, particularly when expressing the full-length receptor with multiple domains. Bacterial expression systems may yield improperly folded proteins that lack native functionality.

  • Post-translational modifications: Chicken EGFR undergoes extensive glycosylation and phosphorylation in vivo, which are critical for its function. Bacterial expression systems lack the machinery for these modifications, potentially affecting the protein's properties.

  • Solubility issues: The transmembrane domain of EGFR can cause solubility problems during expression and purification. Expressing only the extracellular or intracellular domains separately may improve solubility.

  • Autophosphorylation control: When expressing the kinase domain, spontaneous autophosphorylation can occur, making it difficult to obtain the receptor in a specific phosphorylation state for binding studies.

To address these challenges, researchers should consider:

  • Using eukaryotic expression systems for studies requiring fully glycosylated EGFR

  • Employing fusion tags (such as GST) to improve solubility and enable affinity purification

  • Including phosphatase inhibitors during purification to preserve phosphorylation states

  • Considering expression of individual domains for specific studies rather than the full-length receptor

How can binding specificity between chicken EGFR and SH2 domains be accurately assessed?

Determining binding specificity between chicken EGFR and various SH2 domain-containing proteins requires careful experimental design and controls. Based on the literature, several approaches can be employed:

  • Competitive binding assays: These assays compare the abilities of different SH2 domain-containing proteins to inhibit the binding of a reference protein (e.g., Crk) to phosphorylated EGFR . The competitive ELISA methodology allows for quantitative comparison of relative binding affinities.

  • Mutational analysis: Introducing specific mutations in the phosphotyrosine binding pocket of SH2 domains or in the phosphotyrosine residues of EGFR can help identify critical residues for binding specificity.

  • Pull-down assays with varying stringency: Performing pull-down assays under different salt concentrations or detergent conditions can discriminate between high-affinity specific interactions and lower-affinity non-specific binding.

  • Surface plasmon resonance (SPR): This technique provides real-time measurement of binding kinetics and can be used to determine association and dissociation rate constants, which together define binding affinity.

When interpreting binding data, researchers should consider:

  • The phosphorylation state of EGFR, as different phosphotyrosine residues may preferentially bind different SH2 domains

  • The potential for cooperative binding, where the binding of one SH2 domain may influence the binding of others

  • The effects of fusion tags or expression systems on binding properties

  • The differences between binding to denatured versus native conformation of the receptor

What factors affect the reliability of chicken EGFR activation studies?

Several factors can impact the reliability of studies examining chicken EGFR activation:

To ensure reliable activation studies, researchers should:

  • Include appropriate positive and negative controls

  • Verify EGFR expression levels and basal phosphorylation status

  • Perform time-course experiments to capture activation dynamics

  • Use multiple complementary methods to confirm activation status

  • Consider the context of receptor activation (e.g., lipid raft localization)

What are emerging approaches for studying chicken EGFR in cellular signaling networks?

Several cutting-edge approaches are being developed to study chicken EGFR within the context of broader signaling networks:

  • Proximity labeling techniques: Methods such as BioID or APEX can be used to identify proteins in close proximity to EGFR under various conditions, providing insights into dynamic signaling complexes.

  • Live-cell imaging: Fluorescently tagged EGFR combined with advanced microscopy techniques allows for real-time visualization of receptor clustering, internalization, and co-localization with other cellular components.

  • Systems biology approaches: Integration of proteomic, phosphoproteomic, and transcriptomic data to model EGFR signaling networks in chicken cells can reveal emergent properties not apparent from studying individual components.

  • CRISPR-Cas9 genome editing: Creating specific mutations or regulatory element modifications in the endogenous chicken EGFR gene can provide insights into structure-function relationships under physiological expression levels.

  • Multi-RTK analysis: Studying EGFR in conjunction with other RTKs such as c-Met can reveal synergistic or compensatory mechanisms, as suggested by studies showing that the extent of reduction in virus titers depends on the number of RTKs simultaneously affected .

These approaches offer promising avenues for deeper understanding of chicken EGFR biology beyond traditional biochemical and cell biological methods.

How might chicken EGFR research inform therapeutic approaches for viral infections?

Research on chicken EGFR's role in viral entry mechanisms, particularly for influenza A virus (IAV), has significant implications for developing novel therapeutic approaches:

  • RTK inhibitors as antiviral agents: The finding that tyrosine kinase inhibitors can reduce IAV uptake by approximately 70-75% suggests that targeting RTKs including EGFR could be a strategy for developing anti-influenza therapeutics.

  • Combinatorial approaches: Studies indicate that simultaneously targeting multiple RTKs (e.g., EGFR and c-Met) results in greater reduction of virus titers than targeting individual receptors . This suggests that combinatorial approaches may be more effective than single-target strategies.

  • Temporal considerations for intervention: EGFR inhibition is effective at reducing virus titers only when applied during early stages of infection , highlighting the importance of timing for antiviral interventions targeting host factors.

  • Lipid raft-targeted strategies: The finding that IAV attachment leads to rearrangement of signaling platforms in the plasma membrane and co-localization of EGFR with lipid rafts suggests that disrupting these membrane microdomains could impair viral entry.

  • Cross-species implications: Understanding how chicken EGFR facilitates avian influenza virus entry could inform research on zoonotic transmission and species barriers, potentially leading to strategies for preventing pandemic outbreaks.

These research directions have particular relevance given the ongoing concerns about avian influenza and its potential for causing human pandemics.

What unanswered questions remain regarding the developmental roles of chicken EGFR?

Despite significant advances in understanding chicken EGFR, several important questions about its developmental roles remain unanswered:

  • Tissue-specific functions: While EGFR has been detected in various embryonic tissues including kidney and heart , the specific functions in each tissue type are not fully characterized. Why does EGF stimulate protein synthesis in isolated epidermal cells but not in whole embryos?

  • Temporal regulation: EGF binding to chicken tissues during embryonic development reaches a peak at days 10-12 , but the mechanisms regulating this temporal pattern and its developmental significance remain unclear.

  • Ligand specificity: Besides EGF itself, the roles of other potential EGFR ligands (such as TGF-α, amphiregulin, etc.) in chicken embryonic development have not been thoroughly investigated.

  • Receptor trafficking dynamics: How EGFR internalization, recycling, and degradation are regulated during different stages of chicken development remains to be elucidated.

  • Cross-talk with other signaling pathways: The interaction between EGFR signaling and other developmental pathways (such as Wnt, Notch, or BMP signaling) in the context of chicken embryogenesis requires further investigation.

  • Compensation mechanisms: The observation that EGF supplementation does not affect whole-body protein synthesis despite the presence of functional EGFR suggests compensatory mechanisms that warrant exploration.

Addressing these questions will require integrative approaches combining genetics, biochemistry, cell biology, and developmental biology to fully understand the complex roles of EGFR in chicken development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.