Recombinant Chicken Frizzled-10 (FZD10)

Shipped with Ice Packs
In Stock

Description

Functional and Mechanistic Insights

FZD10 receptors bind Wnt ligands to activate canonical (β-catenin-dependent) and non-canonical (calcium/PKC-dependent) signaling pathways . Key functional attributes include:

  • Wnt Signaling: Facilitates cell proliferation, differentiation, and tissue morphogenesis .

  • Disease Relevance: Human FZD10 overexpression correlates with cancer progression (e.g., colon, gastric) , though chicken-specific pathological roles are underexplored.

Research Applications

Recombinant Chicken FZD10 is primarily used for:

  • Antibody Development: Serves as an immunogen for generating species-specific antibodies .

  • Pathway Analysis: Enables studies on Wnt/FZD signaling in avian models .

  • Comparative Studies: Allows cross-species comparisons with mammalian FZD10 homologs .

Table 2: Comparative Features of Recombinant FZD10 Variants

FeatureChicken FZD10 Human FZD10
Production HostE. coliMammalian cells (e.g., HEK293)
TagNone specifiedFc-tagged
PurityNot specified>90% (SDS-PAGE verified)
Key ApplicationsImmunoassays, basic researchCancer research, signal transduction studies

Limitations and Future Directions

  • Species-Specific Data Gap: Most functional insights derive from human/mouse studies , highlighting the need for chicken-focused research.

  • Technical Challenges: Recombinant production in E. coli may limit post-translational modifications critical for native receptor activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
FZD10; FZ10; Frizzled-10; Fz-10; cFz-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-585
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
ISSIDIERPGDGRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCH GHLKFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCSKLPNK NDPNYLCMEAPNNGSDEPPRGSSMLPPMFRPQRPSTGHDLQQHKDSLSRTSCENPGKFHH VEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTFLIDPQRFKYPE RPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQLYVIQEGLESTGCTIVFLVLYYFG MASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRRVAGDEL TGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKTGGENTDKLEKL MVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVASQQKCKMNNQTKNLDCMMNNSIPA VEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVCSRRLKKRSRRKPASVITSSGIYKKP QHPQKTHLAKYESTLQPPTCV
Uniprot No.

Target Background

Function
Frizzled-10 (FZD10) is a receptor for Wnt proteins, playing a crucial role in the canonical Wnt/β-catenin signaling pathway. WNT7A activation triggers β-catenin target gene expression. This canonical pathway involves disheveled protein activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. While some family members exhibit a second signaling pathway involving PKC and calcium fluxes, its distinct nature or integration within the canonical pathway remains unclear; however, PKC appears necessary for Wnt-mediated GSK-3 kinase inactivation. Both pathways seem to involve G-protein interactions. FZD10 may participate in transducing and transmitting polarity information during tissue morphogenesis and/or in differentiated tissues.
Gene References Into Functions
  1. Studies have identified FZD10 as a receptor for WNT1 and WNT3A in developing chick spinal cords. PMID: 24599775
  2. FZD10 is expressed in the dorsal neural tube and dorsal limb bud, overlapping with Wnt7a expression and functionally interacting with Wnt7a, but not Wnt3a. PMID: 11142678
Database Links

KEGG: gga:373885

STRING: 9031.ENSGALP00000004170

UniGene: Gga.109

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the dorsal ectoderm overlying the developing spinal cord.

Q&A

What is Chicken Frizzled-10 (FZD10) and what is its role in the WNT signaling pathway?

Chicken Frizzled-10 (FZD10) is a transmembrane receptor belonging to the Frizzled family that serves as a receptor for Wnt proteins. FZD10, like other Frizzled receptors, is primarily coupled to the β-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of β-catenin, and activation of Wnt target genes . This receptor is involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and in differentiated tissues. The protein plays critical roles in cell fate determination, proliferation, and embryonic development.

Frizzled receptors, including FZD10, participate in two primary signaling pathways:

  • The canonical β-catenin pathway, which regulates gene expression

  • A secondary signaling pathway involving PKC and calcium fluxes

Both pathways appear to involve interactions with G-proteins and are essential for proper development and cellular function in various tissues. In chickens, FZD10 has specific expression patterns that contribute to its specialized developmental roles.

What detection methods are available for Chicken FZD10?

Several detection methods have been developed for studying Chicken FZD10 in research settings:

MethodApplicationDilution RangeNotes
ELISAQuantitative detection1:500-1000High sensitivity and specificity
Western Blot (WB)Protein detection1:300-5000Detects protein size and abundance
Immunohistochemistry (IHC-P)Tissue sections1:200-400Paraffin-embedded tissues
Immunohistochemistry (IHC-F)Frozen sections1:100-500Frozen tissue analysis
Immunofluorescence (IF)Cellular localization1:50-200For both paraffin and frozen sections
Immunocytochemistry (ICC)Cellular studies1:100-500In vitro cellular localization

The commercially available Chicken FZD10 ELISA kit has been reported to be highly sensitive and specific, with no significant cross-reactivity or interference between Chicken FZD10 and analogues. Standard deviation is less than 8% for standards repeated 20 times on the same plate and less than 10% when the same sample is measured 20 times by different operators . This consistency makes it suitable for quantitative research applications requiring reliable detection of FZD10.

How does FZD10 structure relate to its function in signal transduction?

FZD10, like other Frizzled family receptors, has a defined structure that underlies its signaling capabilities. The receptor contains:

  • An N-terminal extracellular cysteine-rich domain (CRD) that serves as the primary binding site for WNT ligands

  • Seven transmembrane domains characteristic of G protein-coupled receptors

  • Intracellular loops that mediate interactions with downstream signaling molecules

  • A C-terminal domain that interacts with Dishevelled (DVL) proteins through its PDZ-binding motif

The structural integrity of FZD10 is critical for proper signaling function. Studies on related Frizzled receptors like FZD2 have shown that single amino acid changes can selectively alter ligand binding, affecting downstream signaling pathways . For instance, missense variants in FZD2 associated with Robinow syndrome demonstrate how point mutations can lead to altered craniofacial development by modifying WNT pathway activation.

The subcellular localization of FZD10 to the cell membrane is essential for its function, allowing it to interact with extracellular WNT ligands and transmit signals intracellularly. Proper membrane insertion and orientation enable FZD10 to function as a signal transducer, connecting extracellular developmental cues to intracellular responses.

What expression systems are optimal for producing recombinant Chicken FZD10?

Producing functional recombinant Chicken FZD10 requires careful consideration of expression systems to ensure proper folding and post-translational modifications. Several expression platforms can be employed:

  • Mammalian Expression Systems:

    • HEK293 and CHO cells provide proper folding and post-translational modifications

    • Transfection methods include calcium phosphate, lipofection, or electroporation

    • Addition of chaperone proteins can enhance folding efficiency

    • Temperature reduction to 30-32°C during expression can improve proper folding

  • Insect Cell Systems:

    • Sf9 or High Five cells with baculovirus vectors offer a good balance of yield and proper folding

    • Scale-up is relatively straightforward in suspension cultures

    • Post-translational modifications are more similar to vertebrate systems than bacterial options

  • Avian-Specific Viral Vectors:

    • RCAS (Replication-Competent ASLV long terminal repeat with a Splice acceptor) retroviruses are particularly useful for chicken-specific studies

    • Allow for stable integration and expression in chicken cells and embryos

    • Particularly valuable for in vivo studies of FZD10 function

  • Purification Considerations:

    • Affinity tags (His, FLAG, GST) facilitate purification

    • Detergent selection is critical for membrane protein extraction

    • Size exclusion chromatography helps achieve high purity

    • Quality control via SDS-PAGE, Western blot, and functional assays is essential

For studies requiring high quantities of purified protein, mammalian or insect cell systems typically yield the most functional protein. For in vivo studies in chicken embryos, RCAS viral vectors have proven effective for delivering and expressing Frizzled family receptors, as demonstrated in studies of related receptors .

What are known functional differences between FZD10 and other Frizzled family members?

While FZD10 shares structural similarities with other Frizzled family members, it has distinct functional characteristics:

  • Ligand Specificity:

    • FZD10 has specific binding affinities for particular WNT ligands that differ from other Frizzled receptors

    • This specificity contributes to its distinct roles in development and signaling

  • Tissue Expression Pattern:

    • FZD10 shows tissue-specific expression patterns that differ from other Frizzled receptors

    • In chickens, expression patterns during embryonic development contribute to its specialized roles

  • Signaling Pathway Bias:

    • The degree to which FZD10 activates canonical versus non-canonical pathways appears to be distinct

    • This signaling bias affects downstream cellular responses

  • Cross-species Conservation:

    • FZD10 shows substantial conservation across species, suggesting important evolutionary functions

    • Due to similarity with FZD9, there can be cross-reactivity in detection methods

  • Pathological Associations:

    • Different Frizzled receptors are associated with specific developmental disorders

    • While FZD2 variants cause Robinow syndrome , FZD10 has distinct pathological associations

Understanding these functional differences is important for researchers designing experiments to investigate FZD10-specific functions versus general Frizzled family properties. The distinct roles of different Frizzled receptors in development and disease make them valuable targets for specialized research questions.

How can Chicken FZD10 be used in developmental biology research?

Chicken FZD10 is a valuable research tool in developmental biology due to the accessibility and manipulability of the chicken embryo system. Several approaches highlight its utility:

  • Expression Analysis:

    • In situ hybridization reveals spatial-temporal expression patterns during development

    • Immunohistochemistry with specific antibodies detects protein localization

    • Single-cell RNA-seq identifies cell populations expressing FZD10 during development

  • Functional Studies:

    • Gain-of-function approaches using RCAS viral vectors to overexpress wild-type or mutant FZD10

    • Loss-of-function studies through morpholinos, dominant-negative constructs, or CRISPR-Cas9

    • Electroporation of expression constructs for targeted tissue analysis

  • Key Developmental Processes:

    • Neural development: FZD10 mediates WNT signaling in neural crest induction and migration

    • Craniofacial morphogenesis: Studies in chicken embryos have demonstrated Frizzled receptors' roles in facial development

    • Limb development: Expression in limb buds suggests roles in proximodistal patterning

    • Feather morphogenesis: WNT signaling regulates feather placode formation and patterning

  • Comparative Developmental Biology:

    • Chicken embryos provide valuable comparisons to mammalian models

    • Conservation of WNT/Frizzled signaling allows insights into evolutionary aspects of development

    • Species-specific adaptations can be identified through comparative studies

The chicken embryo model offers distinct advantages for studying FZD10 function, including:

  • Accessibility for manipulation at various developmental stages

  • Cost-effectiveness compared to mammalian models

  • Ability to perform region-specific gain/loss-of-function studies

  • Rapid development facilitating experimental timelines

Studies using chicken embryos to examine related Frizzled receptors have provided valuable insights into pathogenic mechanisms, as demonstrated by recent work showing that FZD2 variants associated with Robinow syndrome affect craniofacial development and WNT signaling pathways .

What methodological approaches enable differentiation between canonical and non-canonical WNT signaling through FZD10?

Distinguishing between canonical and non-canonical WNT signaling through FZD10 requires specific methodological approaches:

  • Reporter Assays:

    • Canonical Pathway: TOPFlash/FOPFlash luciferase reporters containing TCF/LEF binding sites

    • Non-canonical Pathways: AP-1 reporters for PCP/JNK activation or NFAT reporters for calcium pathway

    • Comparative analysis using wild-type and mutant FZD10 constructs

  • Protein Localization and Trafficking:

    • β-catenin nuclear translocation as a definitive marker of canonical signaling

    • Dishevelled membrane recruitment patterns differ between pathways

    • Cytoskeletal rearrangements indicate non-canonical pathway activation

  • Biochemical Analyses:

    • Phosphorylation of LRP6 indicates canonical pathway activation

    • JNK phosphorylation serves as a marker for PCP pathway activation

    • Calcium flux measurements detect WNT/calcium pathway activation

    • Co-immunoprecipitation identifies pathway-specific protein interactions

  • Functional Readouts:

    • Cell proliferation and gene expression changes typically reflect canonical signaling

    • Cell migration and polarity alterations indicate non-canonical pathway activation

    • Convergent extension movements in tissue explants reflect PCP pathway function

  • Selective Pathway Manipulation:

    • Use of pathway-specific inhibitors (e.g., IWP compounds for WNT secretion, IWR compounds for canonical pathway)

    • Introduction of dominant-negative constructs targeting specific pathway components

    • RNA interference targeting pathway-specific components

Research on FZD2 variants has shown that single amino acid substitutions can selectively impair non-canonical signaling while leaving canonical pathways intact. For example, the p.Pro142Lys variant in FZD2 failed to activate non-canonical WNT reporters above control levels and showed unresponsiveness to exogenous WNT5A . Similar approaches can be applied to study FZD10 signaling specificity.

What are the challenges in expressing and purifying functional recombinant Chicken FZD10?

Expressing and purifying functional recombinant Chicken FZD10 presents several technical challenges due to its nature as a multi-pass transmembrane protein:

  • Expression Challenges:

    • Protein Folding: The seven-transmembrane domain structure requires proper membrane insertion and folding

    • Post-translational Modifications: Glycosylation and other modifications are essential for function

    • Toxicity: Overexpression can cause cellular stress or toxicity

    • Expression Level Control: Balancing between aggregation at high levels and poor yield at low levels

  • Purification Challenges:

    • Membrane Extraction: Selection of appropriate detergents is critical:

    DetergentConcentrationAdvantagesDisadvantages
    DDM0.5-1%Maintains structural integrityLarger micelles
    CHAPS0.5-1%Milder, often preserves functionLess efficient extraction
    Triton X-1000.5-1%Efficient extractionMay affect structure
    Digitonin0.5-1%Preserves protein-protein interactionsVariable quality
    • Protein Stability: Maintaining function after extraction from the membrane

    • Affinity Tag Position: N-terminal tags may interfere with WNT binding; C-terminal tags may disrupt signaling

    • Protein Homogeneity: Achieving consistent glycosylation and conformational states

  • Quality Control Challenges:

    • Functional Verification: Ensuring the purified protein retains WNT-binding capacity

    • Structural Integrity: Confirming proper folding of all domains

    • Aggregation Prevention: Avoiding oligomerization during concentration steps

    • Long-term Stability: Maintaining activity during storage

  • Innovative Solutions:

    • Expression Systems: Insect cell systems often provide a good balance of folding and yield

    • Fusion Strategies: T4 lysozyme fusion or thermostabilizing mutations can improve stability

    • Membrane Mimetics: Nanodiscs or amphipols provide native-like environments for purified protein

    • Co-expression: Adding chaperones or binding partners can improve folding and stability

These challenges necessitate careful optimization of expression and purification protocols, often requiring iterative refinement to obtain functional protein suitable for structural and biochemical studies.

How do post-translational modifications influence FZD10 function and signaling?

Post-translational modifications (PTMs) significantly impact FZD10 function, localization, and signaling properties:

  • Glycosylation:

    • N-linked glycosylation in the extracellular domain affects protein folding and quality control

    • Glycosylation patterns influence WNT ligand binding affinity

    • Proper glycosylation is essential for receptor trafficking to the cell surface

    • Modification provides protection from proteolytic degradation

  • Phosphorylation:

    • Occurs primarily in intracellular loops and C-terminal domains

    • Mediated by kinases such as GRKs, PKC, CK1, and CK2

    • Regulates receptor desensitization and internalization

    • Controls signal duration and pathway selection between canonical and non-canonical signaling

  • Ubiquitination:

    • Mono- and poly-ubiquitination target lysine residues in intracellular domains

    • Regulates receptor internalization and endocytic sorting

    • Controls receptor abundance through proteasomal degradation

    • May have non-degradative signaling roles

  • Palmitoylation:

    • Occurs at cysteine residues near transmembrane domains

    • Enhances membrane association and localization to lipid rafts

    • Regulates receptor oligomerization and signaling efficiency

    • Contributes to stability within the membrane

  • PTM Crosstalk and Regulation:

    • Sequential modifications: Phosphorylation often precedes ubiquitination

    • Competitive modifications: Different modifications may compete for the same sites

    • Developmental regulation: PTM patterns change during development

    • Pathological alterations: Mutation of PTM sites can lead to developmental disorders

Understanding the PTM landscape of Chicken FZD10 is essential for comprehending its role in different cellular contexts. Changes in PTM patterns can significantly alter receptor function, potentially leading to developmental abnormalities or disease states. Research strategies to study PTMs include mass spectrometry, site-directed mutagenesis, and specific inhibitor studies.

What is the role of FZD10 in immune responses in chickens?

While specific information on Chicken FZD10's role in immune responses is limited in the available research, studies on Frizzled family receptors in chicken immune function provide valuable insights:

Network meta-analyses of chicken transcriptome following avian influenza virus challenges have identified differential regulation of Frizzled family receptors. For example, FZD6 was found to be down-regulated in response to influenza infection in multiple tissues . This suggests that Frizzled receptors, potentially including FZD10, may play roles in the host response to viral infections.

Potential mechanisms for FZD10 involvement in immune function include:

  • Regulation of Immune Cell Development:

    • WNT pathways regulate hematopoiesis and lymphocyte development

    • FZD10 may participate in the development of specific immune cell populations

  • Modulation of Inflammatory Responses:

    • WNT/β-catenin signaling regulates inflammatory cytokine production

    • FZD10-mediated signaling might influence the balance between pro- and anti-inflammatory responses

  • Viral Infection Response:

    • In influenza studies, several core genes involved in host response were identified, with Frizzled family members showing differential regulation

    • Down-regulation of certain Frizzled receptors during viral infection suggests potential roles in host defense

  • Cross-talk with Immune Signaling Pathways:

    • WNT pathways interact with other signaling cascades important in immunity, such as NF-κB

    • FZD10 could serve as an integration node for multiple signaling inputs during immune responses

Research approaches to further study FZD10 in immune responses include:

  • Transcriptomic analysis of immune tissues following infection or stimulation

  • Functional studies through overexpression or knockdown in chicken immune cells

  • Signaling pathway analysis in immune contexts

  • Investigation of FZD10 regulation during different types of infections

The differential expression of Frizzled receptors during avian influenza infection suggests potentially important roles in host-pathogen interactions , warranting further investigation into FZD10's specific contributions to chicken immune function.

How can CRISPR-Cas9 genome editing be optimized for studying FZD10 in chicken embryos?

CRISPR-Cas9 genome editing offers powerful approaches to study FZD10 function in chicken embryos, though specific optimization strategies are needed:

  • CRISPR-Cas9 Design Strategies:

    • Gene Knockout: Targeting critical exons of FZD10 to create frameshift mutations

    • Domain-Specific Disruption: Targeting functional domains such as the WNT-binding or DVL-binding regions

    • Knock-in Approaches: Adding reporter genes or epitope tags to study expression and localization

    • Specific Mutation Introduction: Recreating disease-associated variants to study mechanisms

  • Delivery Methods for Chicken Embryos:

MethodStageTarget TissuesAdvantagesDisadvantages
In ovo electroporationHH8-24Neural tube, brainRegion-specific, efficientLimited to accessible tissues
Viral delivery (RCAS)VariousMultiple tissuesStable integrationRequires dividing cells
Ex ovo electroporationHH4-8Early embryonic structuresEarly development accessTechnical complexity
Primordial germ cell modificationVariousGermlineHeritable modificationsTime-consuming
  • Guide RNA Optimization:

    • Design 3-4 guide RNAs targeting different regions of FZD10

    • Perform off-target prediction and verification

    • Test efficiency in chicken cell lines before embryo application

    • Consider species-specific codon usage and genomic features

  • Validation Strategies:

    • Sequencing verification of edits at the genomic level

    • RT-PCR and Western blot confirmation of expression changes

    • Functional assays specific to WNT signaling pathways

    • Phenotypic analysis at various developmental stages

  • Specific Applications for FZD10 Research:

    • Neural crest cell migration and differentiation

    • Craniofacial development comparative studies

    • Feather development and morphogenesis research

    • Analysis of canonical versus non-canonical WNT signaling outcomes

The chicken embryo model, combined with CRISPR-Cas9 technology, provides an efficient system for studying FZD10 function in development. Similar approaches have been successful in studying related Frizzled receptors and WNT pathway components in developmental contexts .

How can researchers distinguish between FZD10 and other Frizzled receptors in experimental settings?

Distinguishing between FZD10 and other Frizzled receptors is critical for accurate experimental results, particularly given the structural similarities within this protein family:

  • Specific Detection Methods:

    • Antibody Selection: Use antibodies raised against unique epitopes of FZD10

    • Validation: Confirm antibody specificity using overexpression and knockdown controls

    • Cross-reactivity Testing: Due to the similarity between FZD10 and FZD9, antibodies should be tested for cross-reactivity

    • Peptide Competition: Use blocking peptides to confirm specific binding

  • Nucleic Acid-based Approaches:

    • PCR Primer Design: Target unique regions of FZD10 mRNA

    • In Situ Hybridization Probes: Design against low-homology regions

    • RNAseq Analysis: Apply stringent mapping parameters to distinguish closely related transcripts

    • qRT-PCR Validation: Confirm with melt curve analysis to ensure amplification specificity

  • Functional Discrimination:

    • Receptor-specific Ligand Binding: Identify WNT ligands with preferential binding to FZD10

    • Signaling Pathway Analysis: Characterize pathway-specific outcomes

    • Rescue Experiments: Test complementation with different Frizzled receptors

    • Domain Swap Experiments: Create chimeric receptors to identify functional specificity

  • Expression Pattern Analysis:

    • Tissue-specific Expression: Map differences in expression patterns between Frizzled receptors

    • Developmental Timing: Analyze temporal expression differences

    • Single-cell Approaches: Identify cell populations with FZD10-specific expression

    • Response to Stimuli: Characterize differential regulation under various conditions

The ELISA kit for Chicken FZD10 has been reported to show no significant cross-reactivity or interference with analogues, making it a useful tool for specific detection . For antibody-based methods, validation is crucial as some antibodies developed against FZD10 may react with FZD9 based on sequence homology .

What experimental approaches can validate FZD10's specific contributions to developmental phenotypes?

Validating FZD10's specific contributions to developmental phenotypes requires a multi-faceted experimental approach:

  • Loss-of-Function Studies:

    • CRISPR-Cas9 Knockout: Generate FZD10-specific deletions in chicken embryos

    • Morpholino Knockdown: Target FZD10 mRNA with specific antisense oligonucleotides

    • Dominant-Negative Constructs: Express truncated forms that interfere with endogenous FZD10

    • Pharmacological Inhibition: Use FZD-specific small molecule inhibitors when available

  • Gain-of-Function Studies:

    • Viral-Mediated Overexpression: Use RCAS viral vectors to overexpress wild-type FZD10

    • Tissue-Specific Expression: Target expression to relevant developmental structures

    • Controlled Activation: Use inducible systems to activate FZD10 at specific developmental stages

    • Structure-Function Analysis: Express domain mutants to identify critical regions

  • Rescue Experiments:

    • Complementation Testing: Determine if other Frizzled receptors can rescue FZD10 loss

    • Domain Swaps: Identify which domains confer FZD10-specific functions

    • Cross-Species Testing: Test if FZD10 from other species can complement chicken FZD10

  • Pathway Analysis:

    • WNT Ligand Specificity: Identify which WNT ligands signal specifically through FZD10

    • Downstream Target Analysis: Identify FZD10-specific transcriptional targets

    • Interaction Partners: Identify FZD10-specific protein interactions

    • Signaling Dynamics: Characterize temporal aspects of FZD10-mediated signaling

  • Phenotypic Assessment:

    • Morphological Analysis: Detailed examination of developmental structures

    • Histological Evaluation: Tissue architecture and cellular organization

    • Marker Expression: Analysis of developmental gene expression patterns

    • Functional Testing: Physiological assessment where applicable

Similar approaches have been successfully used to validate the contributions of related receptors like FZD2 to developmental phenotypes, particularly in craniofacial development . For example, overexpression of human FZD2 variants in chicken embryos led to increased facial width and altered WNT signaling, confirming their pathogenic nature .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.