Recombinant Chicken Frizzled-6 (FZD6)

Shipped with Ice Packs
In Stock

Description

Introduction

Frizzled-6 (FZD6) is a member of the Frizzled family of proteins, which serve as receptors in the Wnt signaling pathway . The Wnt pathway is crucial in regulating various developmental processes, including cell fate determination, tissue polarity, and organogenesis . Recombinant Chicken Frizzled-6 (FZD6) refers to the FZD6 protein produced using recombinant DNA technology in chicken cells, offering a valuable tool for studying its function and interactions.

Production and Characterization of Recombinant Chicken FZD6

Recombinant Chicken FZD6 is produced using various expression systems to ensure its availability for research purposes . The protein's molecular weight and purity are rigorously assessed to confirm its identity and quality . Such recombinant proteins are instrumental in conducting in vitro and in vivo studies to elucidate the specific roles of FZD6 in different biological contexts.

Role in Avian Biology

In avian species, FZD6 plays a crucial role during development. Studies involving chicken embryos have shown that FZD2, a related Frizzled receptor, influences craniofacial development and beak ossification . Although the research specifies FZD2, it suggests the importance of Frizzled proteins in avian developmental processes, potentially extending to FZD6 .

Involvement in Disease

Research indicates that FZD6 dysregulation is implicated in various diseases. Mutations in FZD6 have been associated with isolated autosomal-recessive nail dysplasia, characterized by claw-shaped nails, onychauxis, and onycholysis in humans . While this finding is in human models, it underscores the importance of FZD6 in tissue development and maintenance, suggesting potential implications in avian diseases as well.

Wnt Signaling and FZD6

FZD6 has the ability to interact with both WNT-3A and WNT-5A, recruiting β-catenin-dependent as well as β-catenin-independent pathways . Studies have shown that FZD6 mediates β-catenin-dependent signaling and that FZD6-null mutant cells have lost their capability to respond to WNT-3A stimulation . Furthermore, perturbed response has also been observed to β-catenin-independent WNT-5A stimulation in the absence of FZD6 .

Applications in Research

Recombinant Chicken FZD6 is used in diverse research applications:

  • Signaling Studies: To investigate the specific signaling pathways activated by FZD6 and their downstream effects.

  • Protein Interaction Assays: To identify proteins that interact with FZD6, providing insights into its functional mechanisms.

  • Developmental Biology: To study the role of FZD6 in embryonic development and tissue formation.

Table: Comparison of Frizzled Receptors

FeatureFZD6FZD2
Ligand BindingBinds to Wnt ligands via its cysteine-rich domain (CRD) Binds to Wnt ligands; influences beak ossification
Signaling PathwayActivates both canonical (β-catenin-dependent) and non-canonical Wnt pathways Primarily associated with WNT and BMP pathways
Disease AssociationMutations linked to nail dysplasia in humans Variants associated with craniofacial defects
ExpressionExpressed in various tissues during development Expressed in the frontonasal mass during embryonic development
FunctionRegulates cell fate, tissue polarity, and organogenesis Regulates bone formation and chondrogenesis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FZD6; FZ6; Frizzled-6; Fz-6; cFz-6; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
FGFAWPEELECSRLVNCDETAPATAPVTTNAHGTQKTPGQTRRDYGFWCPRHLHTSNGQG YKFLGIDQCAPPCPNMYFKNYELDVAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPER PIIYYSVCYSIVSLMYFIGFLLGNRTACNKADDKLEIGETVVLGSQNKACTVLFMVLYFF TMAGTIWWVI
Uniprot No.

Target Background

Function

Frizzled-6 (FZD6) is a receptor for Wnt proteins. Most FZD receptors are coupled to the canonical beta-catenin signaling pathway, leading to activation of Dishevelled proteins, inhibition of GSK-3 kinase, nuclear translocation of beta-catenin, and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed in some family members; however, its distinctness or integration with the canonical pathway remains unclear, as PKC appears necessary for Wnt-mediated GSK-3 kinase inactivation. Both pathways appear to involve G-protein interactions. Wnt5A activation stimulates PKC activity via a G-protein-dependent mechanism. FZD6 is involved in the transduction and intercellular transmission of polarity information during tissue morphogenesis and in differentiated tissues. In conjunction with FZD3, it may participate in neural tube closure and regulate the establishment of planar cell polarity (PCP), particularly in the orientation of asymmetric stereocilia bundles on the apical surfaces of specific auditory and vestibular sensory cells within the inner ear.

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell surface. Apical cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.