Recombinant Chicken Frizzled-9 (FZD9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have a specific format requirement, please note it during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
FZD9; FZ9; Frizzled-9; Fz-9; cFz-9; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
ACDNPEKFQYVEKSLSCAPRCSPGVDVYWSREDKDFAFVWMAVWSTLCFVSTAFTVLTFL LDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAETIACDRENGELYIIQEGLESTGCT IVFLILYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHSSYFHMAAWGIPAMKTIVIL TMRKVAGDELTGLCYVGSMDVSALTGFVLIPLSCYLVVGTSFILTGFVALFHIRKIMKTG GTNTEKLEKLMVKIGVFSILYTVPATCVIVCYFYERLNVDYWNLRALERACVPLPGRRAA DCSLEASVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQSLCNRKLGVRTRGKPCSG VSCGGVHCHYKAPTVMLHMTKTDPYLDNPTHV
Uniprot No.

Target Background

Function
Frizzled-9 (FZD9) is a receptor for WNT2. It is involved in the beta-catenin canonical signaling pathway, which activates disheveled proteins, inhibits GSK-3 kinase, leads to nuclear accumulation of beta-catenin, and ultimately activates Wnt target genes.
Database Links

UniGene: Gga.3444

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Chicken Frizzled-9 (FZD9) and what are its structural characteristics?

Recombinant Full Length Chicken Frizzled-9 (FZD9) is a Wnt receptor protein consisting of 392 amino acids (UniProt ID: Q9IA02). The protein exhibits the general structural features characteristic of the Frizzled family receptors, which mediate Wnt signaling pathways crucial for developmental processes. The amino acid sequence of chicken FZD9 includes specific structural elements essential for its receptor function, including the cysteine-rich domain (CRD) that serves as the binding site for Wnt ligands. When produced recombinantly, FZD9 can be expressed with tags such as an N-terminal His tag in expression systems like E. coli for research applications .

How is recombinant chicken FZD9 typically produced for research applications?

Recombinant chicken FZD9 is typically produced using bacterial expression systems, predominantly E. coli. The full-length protein (amino acids 1-392) is expressed with an N-terminal His-tag to facilitate purification. Following expression, the protein undergoes purification processes resulting in a lyophilized powder with purity generally exceeding 90% as determined by SDS-PAGE analysis. The recombinant protein is then formulated in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability. For optimal research use, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (typically 50% final concentration) for long-term storage at -20°C/-80°C to prevent degradation .

What are the key functional roles of FZD9 in vertebrate development?

FZD9 plays crucial roles in vertebrate development through its function as a Wnt signaling receptor. Research indicates that FZD9 is involved in osteoblast differentiation and bone formation, highlighting its importance in skeletal development. Beyond skeletal systems, FZD9 exhibits tissue-specific expression patterns that suggest diverse developmental roles. In cochlear development, FZD9 is expressed in supporting cells (specifically inner phalangeal cells, inner border cells, and third-row Deiters' cells) that can serve as progenitors for hair cell generation. The expression of FZD9 correlates with hair cell generation capacity, with high expression at early postnatal stages (P3) that decreases dramatically with age (lower at P7 and undetectable by P14), paralleling the decline in hair cell regenerative capacity . This temporal expression pattern underscores FZD9's role in regulating cellular differentiation and proliferation in developing tissues.

What are the optimal storage and handling conditions for recombinant chicken FZD9?

For optimal preservation of recombinant chicken FZD9 activity, specific storage and handling protocols must be followed. Upon receipt, the lyophilized protein should be stored at -20°C/-80°C with aliquoting recommended for multiple use scenarios to prevent protein degradation from repeated freeze-thaw cycles. Before opening, briefly centrifuge the vial to bring contents to the bottom. For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. To enhance stability for long-term storage, add glycerol to a final concentration of 5-50% (typically 50% is recommended). Once reconstituted, working aliquots can be stored at 4°C for up to one week, but longer storage requires -20°C/-80°C conditions. It's important to note that repeated freezing and thawing significantly compromises protein integrity and should be strictly avoided .

How can researchers effectively isolate and characterize FZD9 expression in tissue samples?

For effective isolation and characterization of FZD9 expression in tissue samples, researchers can employ several complementary techniques. Quantitative real-time PCR (qRT-PCR) provides a sensitive method for detecting FZD9 transcript levels across different tissues or developmental stages. This approach has successfully demonstrated differential expression of FZD9 in various developmental contexts, such as the high expression in schistosomulum and varying expression levels in adult stages . For protein-level detection, immunohistochemical localization using specific antibodies against FZD9 can reveal tissue distribution patterns. This approach has shown broad tissue distribution of FZD9 in structures like subtegumental musculature and reproductive organs .

For lineage tracing studies, genetic approaches using Cre-lox systems have proven valuable. The Fzd9-CreER/Rosa26-tdTomato mouse model allows for tamoxifen-inducible labeling of Fzd9-expressing cells and their progeny. This approach has revealed specific expression in supporting cells of the neonatal mouse cochlea, including inner phalangeal cells, inner border cells, and third-row Deiters' cells . Combining these methodologies provides a comprehensive view of FZD9 expression patterns that can inform functional studies.

What methods can be used to study FZD9-mediated signaling pathways in cellular models?

To effectively study FZD9-mediated signaling pathways in cellular models, researchers can employ multiple complementary approaches. Overexpression studies using plasmid vectors containing the FZD9 coding sequence can reveal the effects of increased FZD9 activity on downstream pathways. This approach has demonstrated that FZD9 overexpression can counteract simulated microgravity-induced osteoblast dysfunction . Western blot analysis of phosphorylated pathway components (pGSK3β, β-catenin, pAkt, and pERK) helps elucidate which signaling cascades are activated downstream of FZD9. Interestingly, FZD9 overexpression regulates phosphorylation of Akt and ERK while not affecting pGSK3β and β-catenin expression or subcellular localization in certain contexts .

Immunofluorescence and confocal microscopy can visualize cytoskeletal changes induced by FZD9 signaling, such as F-actin polymerization and formation of actin caps. This technique has revealed that FZD9 activation induces nuclear translocation of YAP, a key mechano-transducer. For functional studies, sphere-forming assays can assess the proliferative capacity of FZD9-expressing cells when cultured in vitro, as demonstrated with Fzd9+ cochlear supporting cells . Combining these methodologies provides a comprehensive understanding of FZD9's role in different signaling contexts.

How does FZD9 function in mechanotransduction pathways in osteoblasts?

Frizzled-9 (FZD9) plays a crucial role in mechanotransduction pathways in osteoblasts, particularly in counteracting microgravity-induced dysfunction. Under simulated microgravity (SMG) conditions, osteoblasts exhibit decreased expression of osteogenic markers coinciding with reduced FZD9 expression. This relationship extends to in vivo models, where FZD9 expression decreases in the femurs of rats subjected to hindlimb unloading for three weeks .

Mechanistically, FZD9 functions through non-canonical pathways independent of β-catenin signaling in this context. When overexpressed in osteoblasts, FZD9 does not affect SMG-induced changes in pGSK3β and β-catenin expression or subcellular localization. Instead, FZD9 activates alternative signaling cascades involving Akt and ERK phosphorylation. The most significant mechanotransduction function of FZD9 involves cytoskeletal reorganization, where it induces F-actin polymerization to form an actin cap that exerts mechanical force on the nucleus .

This mechanical force results in increased nuclear pore size, facilitating the nuclear translocation of Yes-associated protein (YAP), a key mechano-transducer. Through this pathway, FZD9 enables the cell to respond to mechanical stimuli and maintain osteoblast function under microgravity conditions. This mechanism positions FZD9 as a potential therapeutic target for bone diseases and for preventing bone loss during space flight .

What is the relationship between FZD9 expression and progenitor cell capabilities in the inner ear?

The relationship between FZD9 expression and progenitor cell capabilities in the inner ear reveals a specific temporal and spatial pattern crucial for hair cell regeneration. FZD9 is expressed in a subset of supporting cells in the neonatal mouse cochlea, specifically inner phalangeal cells, inner border cells, and third-row Deiters' cells. These Fzd9+ supporting cells demonstrate properties consistent with hair cell progenitors .

Temporally, FZD9 expression correlates strongly with the hair cell regeneration capacity of the cochlea. Expression is high at postnatal day 3 (P3), significantly lower by P7, and undetectable by P14, mirroring the rapid decline in hair cell generation ability after P7 in mice. This temporal expression pattern suggests FZD9 could serve as a marker for hair cell progenitors with regenerative potential .

Functionally, Fzd9+ cells demonstrate proliferative and differentiation capabilities comparable to established Lgr5+ progenitors. In sphere-forming assays, isolated Fzd9+ cells form spheres in numbers and sizes similar to Lgr5+ progenitors. Both cell populations show age-dependent decreases in proliferative capacity, with fewer and smaller spheres generated from P12 cells compared to P5 cells. Importantly, Fzd9 appears to mark a more restricted progenitor population than Lgr5, potentially providing a more precise tool for identifying cells with hair cell regeneration potential. These findings suggest that targeting FZD9-expressing cells could offer therapeutic strategies for hearing loss treatment .

How do post-translational modifications affect FZD9 function and signaling specificity?

Post-translational modifications (PTMs) significantly influence FZD9 function and signaling specificity, though this remains an area requiring further research. The 392-amino acid chicken FZD9 protein contains multiple potential sites for PTMs that can modulate receptor trafficking, ligand binding affinity, and downstream signaling pathway selection . Glycosylation likely plays a crucial role in proper FZD9 folding and membrane localization, as observed in other Frizzled family members. The extracellular cysteine-rich domain contains conserved motifs that may undergo disulfide bond formation, essential for creating the three-dimensional structure required for Wnt ligand recognition.

Phosphorylation represents another key modification affecting FZD9 function. While not directly demonstrated for chicken FZD9, research on mammalian Frizzled receptors indicates that phosphorylation events, particularly at serine/threonine residues in the intracellular loops and C-terminal tail, regulate receptor internalization and recycling. These phosphorylation events may determine whether FZD9 signals through canonical (β-catenin-dependent) or non-canonical pathways.

In osteoblasts, FZD9 signaling specificity appears to favor non-canonical pathways activating Akt and ERK phosphorylation rather than affecting β-catenin expression or localization . This pathway selectivity may be regulated by specific PTMs under different cellular contexts. Understanding these modifications could provide insights into how FZD9 functions differently across tissues and developmental stages.

How does chicken FZD9 compare structurally and functionally to its homologs in other species?

Chicken Frizzled-9 (FZD9) shares fundamental structural features with its homologs across species while exhibiting species-specific variations that may reflect evolutionary adaptations. At 392 amino acids in length, the chicken FZD9 protein (UniProt ID: Q9IA02) is generally similar in size to mammalian orthologs, though shorter than the 923 amino acid Frizzled homolog (SjFz9) found in Schistosoma japonicum . All FZD9 proteins across species contain the characteristic structural elements of Frizzled family receptors, including the extracellular cysteine-rich domain (CRD) that facilitates Wnt ligand binding, seven transmembrane domains, and intracellular domains for downstream signaling interactions.

What are the experimental considerations when using recombinant FZD9 in receptor-ligand binding studies?

When conducting receptor-ligand binding studies with recombinant FZD9, researchers must consider several critical experimental factors to ensure valid and reproducible results. First, the proper folding and conformation of recombinant FZD9 is essential, as the cysteine-rich domain (CRD) requires correct disulfide bond formation for appropriate Wnt ligand recognition. The expression system significantly impacts protein folding—while E. coli-expressed FZD9 (as described in search result ) offers high yield, mammalian expression systems may provide more native-like post-translational modifications, particularly glycosylation, which can affect binding properties.

Buffer composition represents another crucial consideration, as pH, ionic strength, and the presence of divalent cations can significantly influence FZD9-Wnt interactions. Typically, physiological conditions (pH 7.4) with calcium (1-2 mM) are recommended, as Wnt-Frizzled interactions often show calcium dependency. Researchers should also consider the detergent used for membrane protein solubilization, as different detergents can affect the conformation and binding properties of transmembrane proteins like FZD9.

For binding assays, multiple methodologies should be employed for confirmation, including surface plasmon resonance (SPR), enzyme-linked immunosorbent assay (ELISA), and fluorescence-based techniques. Competitive binding assays using known Wnt ligands can help establish specificity. Additionally, researchers should include appropriate controls, such as denatured FZD9 (negative control) and established Wnt-Frizzled pairs (positive control), to validate the experimental system.

How can FZD9-based research contribute to therapeutic approaches for bone disorders and hearing loss?

FZD9-based research offers promising avenues for developing therapeutic approaches for both bone disorders and hearing loss. For bone disorders, particularly those characterized by decreased osteoblast function or microgravity-induced bone loss, FZD9 presents a potential intervention target. Research has demonstrated that FZD9 overexpression can counteract simulated microgravity-induced osteoblast dysfunction through activation of Akt and ERK phosphorylation and induction of F-actin polymerization, which ultimately promotes nuclear translocation of YAP, a key mechano-transducer . This mechanism suggests that pharmaceutical compounds enhancing FZD9 expression or activity could protect against bone loss during extended space flight or in osteoporotic conditions.

In hearing loss therapeutics, FZD9's specific expression in cochlear supporting cells capable of generating hair cells positions it as a potential marker or target for regenerative approaches. The correlation between FZD9 expression and hair cell regenerative capacity in mice suggests that stimulating or maintaining FZD9 expression might extend the window for hair cell regeneration . Gene therapy approaches targeting FZD9+ supporting cells or small molecules that enhance FZD9 signaling could potentially promote hair cell regeneration in damaged cochleae.

For both applications, detailed understanding of FZD9's tissue-specific signaling networks is essential. The finding that FZD9 may signal through different pathways in different contexts (canonical versus non-canonical Wnt signaling) suggests that therapeutic approaches may need to be tailored to specific tissues or conditions. Further research into the molecular determinants of these signaling preferences could enable more precise therapeutic interventions targeting FZD9-mediated pathways.

How should researchers interpret conflicting data regarding FZD9 signaling in different cellular contexts?

When encountering conflicting data regarding FZD9 signaling across different cellular contexts, researchers should systematically evaluate several factors that might explain these discrepancies. First, cellular context is paramount—FZD9 may activate different downstream pathways depending on the cell type, developmental stage, and microenvironment. This context-dependency is evident in the observation that FZD9 overexpression in osteoblasts under simulated microgravity affects Akt and ERK phosphorylation but not β-catenin signaling , while FZD9 may utilize different signaling mechanisms in other tissues.

The specific experimental conditions, including the presence of endogenous Wnt ligands, expression levels of co-receptors (such as LRP5/6), and the availability of intracellular signaling components, can significantly influence which pathway is preferentially activated. Additionally, different post-translational modifications of FZD9 across cell types may redirect signaling toward canonical or non-canonical pathways.

To resolve conflicting data, researchers should employ multiple complementary techniques to assess signaling pathway activation, including both protein-level analyses (Western blotting, immunofluorescence) and functional readouts (reporter assays, target gene expression). Cross-validation across different model systems and careful documentation of experimental conditions are essential. Researchers should consider that apparent conflicts may actually reveal biologically relevant signaling diversity rather than experimental artifacts. This perspective can lead to deeper insights into how FZD9 functions as a signaling hub that integrates multiple inputs to produce context-appropriate outputs.

What statistical approaches are most appropriate for analyzing FZD9 expression data across developmental stages?

For analyzing FZD9 expression data across developmental stages, researchers should employ statistical approaches that account for temporal patterns and biological variability. When examining continuous developmental time courses, such as the dramatic decrease in FZD9 expression from P3 to P14 in cochlear development , repeated measures ANOVA or mixed-effects models are appropriate as they accommodate the non-independence of measurements across time points within the same experimental series.

For comparing discrete developmental stages, such as expression differences between schistosomulum and adult stages of Schistosoma japonicum , standard ANOVA with post-hoc tests (Tukey's HSD or Bonferroni correction) can identify significant differences while controlling for multiple comparisons. When sample sizes are small, as is common in developmental biology, non-parametric alternatives such as Kruskal-Wallis with Dunn's post-hoc test may be more appropriate.

Correlation analyses can reveal relationships between FZD9 expression and functional outcomes. For instance, Pearson or Spearman correlation coefficients could quantify the relationship between FZD9 expression levels and hair cell regenerative capacity across developmental stages. For more complex relationships, regression models (linear or non-linear) can determine how FZD9 expression predicts developmental outcomes while controlling for covariates.

Data visualization is crucial for interpreting developmental expression patterns. Time-course plots with error bars representing biological replicates, heat maps showing expression across multiple tissues/stages, and box plots comparing discrete developmental points all provide complementary views of the data. Regardless of the statistical approach, researchers should report effect sizes alongside p-values to convey biological significance beyond statistical significance.

What technical challenges exist in differentiating between canonical and non-canonical Wnt signaling downstream of FZD9?

Differentiating between canonical and non-canonical Wnt signaling downstream of FZD9 presents several technical challenges that researchers must address for accurate pathway characterization. One fundamental challenge is pathway overlap—many components participate in both canonical and non-canonical signaling, making clean separation difficult. Additionally, activation of one pathway can influence the other through cross-talk mechanisms, further complicating interpretation.

The temporal dynamics of signaling present another challenge, as canonical and non-canonical pathways may activate with different kinetics. The β-catenin pathway typically shows slower activation compared to calcium or planar cell polarity pathways. Therefore, single-timepoint measurements may miss crucial signaling events, necessitating time-course experiments that are resource-intensive.

Technically, measuring canonical pathway activation relies heavily on assessing β-catenin nuclear translocation or TCF/LEF-dependent transcription, while non-canonical pathways require measuring diverse endpoints including calcium flux, JNK phosphorylation, or cytoskeletal rearrangements. These diverse readouts require different experimental techniques, making comprehensive pathway analysis complex.

To address these challenges, researchers should employ multiple complementary approaches. These include:

  • Reporter systems with pathway-specific readouts (TOPFlash for canonical, AP-1 reporters for non-canonical)

  • Pharmacological inhibitors specific to each pathway

  • Genetic approaches using dominant-negative or constitutively active pathway components

  • Live-cell imaging to capture temporal dynamics

  • Quantitative proteomics to identify pathway-specific protein interactions

The observation that FZD9 overexpression in osteoblasts regulates Akt and ERK phosphorylation without affecting β-catenin exemplifies how careful experimental design can distinguish between different signaling modalities downstream of this receptor.

What are the most promising avenues for translational research involving FZD9 in regenerative medicine?

Translational research involving FZD9 holds significant promise for regenerative medicine applications, particularly in bone disorders and hearing loss. For bone-related applications, FZD9's ability to counteract simulated microgravity-induced osteoblast dysfunction through YAP-mediated mechanotransduction provides a foundation for developing therapeutics targeting bone loss conditions. Future translational efforts should focus on developing small molecules or biologics that enhance FZD9 expression or activity specifically in osteoblasts. Such compounds could potentially prevent bone loss during extended space missions or provide treatment options for osteoporosis and other degenerative bone disorders.

In hearing loss applications, the identification of FZD9 as a marker for cochlear supporting cells with hair cell regenerative capacity opens avenues for targeted regenerative approaches. Translational research should explore gene therapy vectors delivering FZD9 or its downstream effectors to supporting cells in damaged cochleae. Additionally, high-throughput screening for compounds that enhance FZD9 signaling specifically in cochlear supporting cells could yield pharmacological interventions to promote endogenous hair cell regeneration.

For both applications, developing targeted delivery systems represents a critical research priority. Bone-targeting nanoparticles containing FZD9-activating compounds could enhance therapeutic efficacy while minimizing off-target effects. Similarly, inner ear drug delivery systems, such as round window microcatheters or nanoparticle-based approaches, could enable precise delivery of FZD9-modulating agents to cochlear supporting cells. These translational approaches could ultimately lead to clinically viable therapies for conditions that currently have limited treatment options.

How might single-cell sequencing technologies advance our understanding of FZD9 function in developmental contexts?

Single-cell sequencing technologies offer transformative potential for understanding FZD9 function in developmental contexts by revealing cell-type-specific expression patterns and signaling networks with unprecedented resolution. By applying single-cell RNA sequencing (scRNA-seq) to developing tissues known to express FZD9, researchers can identify the precise cellular populations expressing this receptor and track how these populations evolve throughout development. This approach could reveal previously unrecognized FZD9-expressing cell populations and elucidate the heterogeneity within known expressing populations, such as cochlear supporting cells .

Beyond expression mapping, single-cell approaches can illuminate the consequences of FZD9 signaling on cellular states. By comparing transcriptional profiles of FZD9-expressing and non-expressing cells within the same tissue, researchers can identify genes and pathways regulated downstream of FZD9 activation. Temporal scRNA-seq during development could reveal how FZD9-expressing cells transition between states, potentially identifying the molecular mechanisms underlying their progenitor capabilities.

Emerging technologies like single-cell ATAC-seq could further elucidate how FZD9 signaling influences chromatin accessibility and epigenetic regulation during development. Spatial transcriptomics approaches would preserve the critical information about cellular locations and niches that influence FZD9 function. Additionally, single-cell multi-omics methods combining transcriptome, proteome, and epigenome analysis could provide integrated views of how FZD9 coordinates multiple layers of cellular regulation during development. These technologies collectively promise to transform our understanding of FZD9's developmental roles from broad tissue-level generalizations to precise cellular mechanisms.

What novel experimental models could advance our understanding of FZD9 function in specialized tissues?

Advancing our understanding of FZD9 function in specialized tissues requires the development and application of novel experimental models that better recapitulate the complexity of in vivo environments. Organoid models represent one promising approach, particularly for studying FZD9 in cochlear development and hair cell regeneration. Cochlear organoids derived from stem cells or isolated Fzd9+ supporting cells could provide three-dimensional models for studying how FZD9 influences progenitor cell behavior in a more physiologically relevant context than monolayer cultures. These organoids would enable longitudinal imaging of FZD9-expressing cells during differentiation and response to damage.

For bone research, bone-on-chip microfluidic devices incorporating mechanical stimulation capabilities could elucidate how FZD9 participates in mechanotransduction under precisely controlled conditions. These devices could simulate various mechanical environments, including microgravity, and allow real-time visualization of cytoskeletal changes and YAP translocation in response to FZD9 activation .

Genetically engineered animal models with conditional or inducible FZD9 expression/deletion would enable tissue-specific and temporal control over FZD9 function. CRISPR-based approaches for endogenous tagging of FZD9 with fluorescent proteins could facilitate live imaging of receptor dynamics in developing tissues. For more rapid screening, CRISPR libraries targeting FZD9-interacting proteins could identify novel components of FZD9 signaling networks.

Cross-species comparative models examining FZD9 function in organisms with different regenerative capacities (such as zebrafish, chickens, and mammals) could reveal evolutionary adaptations in FZD9 signaling that correlate with regenerative potential. These diverse experimental approaches, used in combination, would provide complementary insights into FZD9's specialized functions across different tissues and developmental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.