Recombinant Chicken FUN14 domain-containing protein 1 (FUNDC1)

Shipped with Ice Packs
In Stock

Description

Structure and Function of FUNDC1

FUNDC1 is an outer mitochondrial membrane protein with a highly conserved sequence across species, from Drosophila melanogaster to Homo sapiens . Discovered in 2012, human FUNDC1 contains 155 amino acids and has three transmembrane fragments . The N-terminal (AAs1-50) is exposed in the cytoplasm, while the C-terminal extends into the membrane gap .

FUNDC1 functions as an autophagic receptor, targeting damaged organelles for degradation by interacting with microtubule-associated protein 1 light chain 3 (MAP1LC3) members . Specifically, FUNDC1 preferentially interacts with LC3 through its LC3 interaction region (LIR), which contains a Y18-E19-V20-L21 motif . Mutations in this LIR motif can impair the interaction with LC3 and disrupt mitophagy .

Besides inducing mitophagy, FUNDC1 is also involved in maintaining normal mitochondrial morphology and function in cardiomyocytes . It interacts with inositol-1,4,5-triphosphate receptor 2 (IP3R2), modulating Ca2+ release from the endoplasmic reticulum (ER) into the mitochondria and cytoplasm . Disruption of this interaction leads to decreased Ca2+ levels, triggering mitochondrial dysfunction and cardiac issues .

Additionally, FUNDC1 interacts with calnexin (CNX) under basal conditions, and this interaction decreases during mitophagy . The exposed cytoplasmic loop of FUNDC1 then interacts with dynamin-related protein 1 (DRP1), promoting mitochondrial fission . FUNDC1 is also involved in activating the unfolded protein response (UPRmt) for mitochondrial quality control, participating in analgesia with hyperbaric oxygen, promoting adaptive thermogenesis, and regulating body metabolism .

Role in Mitophagy and Cardioprotection

Mitophagy, mediated by FUNDC1, plays a critical role in cardioprotection . The levels and phosphorylation status of FUNDC1 are highly associated with heart disease . Mitophagy can be activated by dephosphorylation of Ser13 and Tyr18 sites, phosphorylation of Ser17 site, and ubiquitination of Lys119 site in FUNDC1 .

By regulating mitophagy, the quality of mitochondria can be effectively controlled, preventing both the accumulation of damaged mitochondria and excessive mitophagy-induced apoptosis . FUNDC1-mediated mitophagy is also involved in exercise preconditioning (EP) for cardioprotection . Impairment of FUNDC1-induced mitophagy results in the accumulation of damaged mitochondria, exacerbating cardiac infarction .

FUNDC1 and Mitochondrial Dynamics

FUNDC1 regulates mitochondrial morphology by interacting with proteins like OPA1 and DRP1 . Suppression of FUNDC1 in HeLa cells leads to increased mitochondrial fusion, while overexpression impedes fusion . Under normal conditions, FUNDC1 interacts with OPA1, but this interaction decreases under stress . FUNDC1 recruits DRP1 to mitochondria, promoting mitochondrial fission . In cardiomyocytes, FUNDC1 deficiency causes mitochondrial elongation .

Clinical Significance

FUNDC1 has been found to predict poor prognosis and promote progression in certain cancers . Studies have shown that FUNDC1 depletion can induce a reduction in the LC3BⅡ/Ⅰ ratio, implying reduced expression of FUNDC1 in cancer cells .

FUNDC1-mediated MERCs exert a cardioprotective effect by restoring blocked autophagosome biogenesis . Overexpression of FUNDC1 can restore MERCs structures in cardiomyocytes treated with doxorubicin (DOX), a drug known for its cardiotoxic effects .

Research Methods and Analysis

Various methods are employed to study FUNDC1, including:

  • Enrichment analysis: Using tools like the Xiantao academic online analysis tool to identify genes associated with FUNDC1 and performing Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) analyses to annotate their functions .

  • Gene set enrichment analysis (GSEA): Utilizing databases to investigate the molecular mechanisms and signaling pathways of FUNDC1 .

  • Immune infiltration analysis: Exploring the association between FUNDC1 expression and immune cell infiltration using databases like TIMER .

  • Statistical analysis: Using software like SPSS and GraphPad Prism for statistical analyses and image processing .

  • Microscopy techniques: Including confocal microscopy and transmission electron microscopy to visualize mitochondrial and ER structures and their interactions .

Tables and Data

VariableNumberLow expression n (%)High expression n (%)P value
Age0.144
≤6011050 (45.5%)60 (54.5%)
>6012471 (57.3%)53 (42.7%)
Grade0.001
1-214357 (39.9%)86 (60.1%)
39164 (70.3%)27 (29.7%)
FIGO stage0.003
I-II18370 (38.3%)113 (61.7%)
III-IV5140 (78.4%)11 (21.6%)
Lymph node metastasis0.001
No19773 (37.1%)124 (62.9%)
Yes3733 (89.2%)4 (10.8%)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
FUNDC1; FUN14 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MAARRPRTAPEHESDDDSYEVLDLTEYARRHHWWNRLFGRNSGPIVEKYSVATQIVMGGV TGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQVDWKRVEKDVNKAKKQLKKRANK AAPEINTLIEESTEFIKQNIVVSSGFVGGFLLGLAS
Uniprot No.

Target Background

Function
Acts as an activator of hypoxia-induced mitophagy, a crucial mechanism for mitochondrial quality control.
Database Links
Protein Families
FUN14 family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is chicken FUNDC1 and what is its primary function?

Chicken FUNDC1 is a mitophagy receptor protein that contains a conserved FUN14 domain. Its primary function is to mediate the selective removal of dysfunctional mitochondria (mitophagy) under hypoxic conditions. Like its mammalian counterpart, chicken FUNDC1 likely plays an essential role in maintaining mitochondrial homeostasis and cellular adaptation to oxygen deprivation . The protein is part of a phylogenetically ancient family present across eukaryotes, archaea, and bacteria, highlighting its evolutionary significance .

FUNDC1 functions by binding directly to LC3 through its LIR (LC3-interacting region) motif, typically characterized as Y-x-x-L in mammals. This interaction recruits the autophagy machinery to damaged mitochondria, facilitating their elimination . Unlike BNIP3 and NIX, which are transcriptionally upregulated during hypoxia, FUNDC1 is constitutively expressed and regulated post-translationally through phosphorylation and ubiquitylation events .

What are the basic protocols for expressing recombinant chicken FUNDC1?

Recombinant chicken FUNDC1 can be expressed using standard molecular biology techniques with specific considerations for avian proteins:

  • Gene Synthesis and Cloning:

    • Obtain the chicken FUNDC1 coding sequence from databases or by PCR amplification from chicken cDNA.

    • Clone into an appropriate expression vector with a purification tag (His, GST, or FLAG).

    • Consider codon optimization for the expression system of choice.

  • Expression Systems:

    • Prokaryotic expression: Use E. coli BL21(DE3) or derivatives for high-yield production.

    • Eukaryotic expression: Consider using avian cell lines like DF-1 (chicken fibroblasts) for proper post-translational modifications.

    • For mammalian expression, HEK293 or CHO cells provide good yields with appropriate modifications.

  • Culture Conditions:

    • For chicken primary cells, isolate myoblasts from E18 embryos and culture at 37°C as described in conventional protocols .

    • For hypoxia studies, place cultures in a gas-tight hypoxic chamber (1% O₂/5% CO₂/94% N₂) for 24 hours, with controls maintained at normoxic conditions (5% CO₂/95% O₂) .

  • Purification Strategy:

    • Implement affinity chromatography based on the chosen tag.

    • Follow with size exclusion chromatography to enhance purity.

    • Verify protein integrity through SDS-PAGE and Western blotting using antibodies against FUNDC1 or the tag.

How do I study the role of FUNDC1 in hypoxia-induced mitophagy in chicken cells?

Studying FUNDC1's role in hypoxia-induced mitophagy in chicken cells requires a multi-faceted approach:

  • Establishing Hypoxic Conditions:

    • Culture chicken primary myoblasts isolated from E18 embryos under controlled hypoxic conditions (1% O₂/5% CO₂/94% N₂) for 24 hours .

    • Use a specialized hypoxic chamber to maintain consistent oxygen levels throughout experiments.

  • FUNDC1 Expression Analysis:

    • Quantify FUNDC1 mRNA levels using qRT-PCR under normoxic versus hypoxic conditions.

    • Assess protein expression changes via Western blotting with FUNDC1-specific antibodies.

    • Perform immunofluorescence microscopy to examine subcellular localization changes during hypoxia.

  • Mitophagy Assessment:

    • Use fluorescent mitochondrial dyes (MitoTracker) combined with lysosomal markers to visualize mitochondrial degradation.

    • Quantify mitochondrial mass using flow cytometry after MitoTracker staining.

    • Measure mitochondrial DNA copy number relative to nuclear DNA via qPCR.

    • Assess colocalization of FUNDC1 with LC3 through immunofluorescence or proximity ligation assays.

  • Functional Manipulation:

    • Implement CRISPR-Cas9 to generate FUNDC1 knockout in chicken cell lines (similar to XCR1 knockin approach described for other chicken proteins) .

    • Alternatively, use siRNA for transient knockdown of FUNDC1.

    • Compare mitophagy levels between wild-type and FUNDC1-deficient cells under hypoxia.

What phosphorylation sites regulate chicken FUNDC1 activity and how do they compare to mammalian orthologues?

The regulation of chicken FUNDC1 through phosphorylation is an important area of investigation:

  • Predicted Phosphorylation Sites:
    Based on mammalian studies, key phosphorylation sites likely include:

    • Serine residues equivalent to human Ser13 (regulated by ULK1)

    • Tyrosine residues equivalent to human Tyr18 (in the LIR motif)

    • Serine residues equivalent to human Ser17 (regulated by CK2)

  • Evolutionary Conservation Analysis:

    • Phylogenetic analysis suggests that FUNDC1 may lack certain phosphorylation regulatory mechanisms in fishes that are conserved in land vertebrates .

    • This differential regulation may reflect adaptation to changing atmospheric oxygen levels during vertebrate evolution from aquatic to terrestrial environments .

  • Experimental Verification Methods:

    • Mass spectrometry analysis of purified chicken FUNDC1 under various conditions.

    • Site-directed mutagenesis to generate phospho-mimetic (S→D or Y→E) and phospho-deficient (S→A or Y→F) mutants.

    • Phospho-specific antibodies to track phosphorylation status during hypoxia.

    • In vitro kinase assays to identify chicken kinases responsible for FUNDC1 phosphorylation.

How does chicken FUNDC1 interact with other mitochondrial quality control proteins?

The interaction network of chicken FUNDC1 with other mitochondrial proteins can be studied through these approaches:

  • Mitochondrial Dynamics Proteins:

    • In mammals, FUNDC1 interacts with OPA1 and DRP1 to coordinate mitochondrial dynamics .

    • Investigate these interactions in chicken cells through co-immunoprecipitation assays.

    • Perform proximity ligation assays to visualize protein interactions in situ.

    • Use live-cell imaging to track dynamics of fluorescently tagged FUNDC1 and DRP1 during hypoxia.

  • ER-Mitochondria Contact Proteins:

    • FUNDC1 serves as an interface between mitochondria and endoplasmic reticulum in mammals .

    • Examine if chicken FUNDC1 localizes to mitochondria-associated ER membranes (MAMs).

    • Investigate potential interactions with chicken orthologues of MAM proteins.

  • LC3 Interaction and LIR Motif:

    • The LIR motif (Y-x-x-L) is critical for FUNDC1-mediated mitophagy in mammals .

    • Compare binding affinity of chicken FUNDC1 to LC3 with that of other mitophagy receptors like NIX.

    • Use pull-down assays with recombinant proteins to quantify interaction strength.

    • Perform mutational analysis of the putative chicken FUNDC1 LIR motif.

What is the role of chicken FUNDC1 in the context of woody breast myopathy?

Woody breast myopathy (WBM) is characterized by mitochondrial dysfunction in chicken muscles, making FUNDC1's mitophagy function potentially relevant:

  • Expression Patterns in Affected Tissues:

    • Compare FUNDC1 expression levels between normal and WBM-affected muscle tissues.

    • Assess correlations between FUNDC1 expression and severity of mitochondrial abnormalities.

    • Examine if FUNDC1-mediated mitophagy is impaired in WBM tissues.

  • Experimental Approaches:

    • Utilize electron microscopy to examine mitochondrial morphology in WBM samples .

    • Perform immunohistochemical analysis to localize FUNDC1 in muscle sections.

    • Measure key mitochondrial parameters (membrane potential, ATP production) in relation to FUNDC1 activity.

    • Develop an in vitro model using primary myoblasts to study hypoxia responses .

  • Potential Therapeutic Implications:

    • Investigate whether enhancing FUNDC1-mediated mitophagy could alleviate mitochondrial dysfunction.

    • Test compounds known to activate mitophagy pathways in mammalian systems.

    • Develop genetic approaches to modulate FUNDC1 expression in chicken muscle cells.

How can I design a CRISPR-Cas9 knockin approach to study FUNDC1 in vivo in chickens?

Based on successful strategies used for other chicken genes like XCR1 , a CRISPR-Cas9 knockin approach for FUNDC1 would include:

  • Target Design:

    • Select guide RNAs targeting the FUNDC1 locus with minimal off-target effects.

    • Design a donor template containing:

      • Homology arms (~800bp each) flanking the FUNDC1 coding region

      • Reporter gene (e.g., RFP) for visualization

      • Optional inducible system (e.g., iCaspase9 for conditional ablation)

  • Delivery Method:

    • Inject CRISPR-Cas9 components into newly fertilized chicken eggs.

    • Alternatively, transfect primordial germ cells (PGCs) ex vivo and reintroduce them.

  • Screening and Validation:

    • Screen founder birds by PCR and sequencing to identify successful knockin events.

    • Confirm expression pattern using fluorescence microscopy of tissues.

    • Validate knockin functionality through Western blot and functional assays.

  • Phenotypic Analysis:

    • Examine tissues for altered mitochondrial dynamics, especially under hypoxic stress.

    • Study development and function of tissues with high mitochondrial demands.

    • Challenge birds with hypoxic conditions and assess physiological responses.

What are the best antibodies and detection methods for chicken FUNDC1?

When working with chicken FUNDC1, antibody selection requires careful consideration:

  • Commercial Antibody Options:

    • Most commercial antibodies are developed against mammalian FUNDC1.

    • Select antibodies raised against conserved epitopes in the FUN14 domain.

    • Validate antibody cross-reactivity with chicken FUNDC1 before extensive use.

  • Custom Antibody Development:

    • Consider developing custom antibodies against chicken-specific FUNDC1 peptides.

    • Choose unique epitopes that distinguish FUNDC1 from FUNDC2.

    • Validate specificity using FUNDC1 knockout or knockdown samples as negative controls.

  • Detection Methods:

    • Western blotting: Optimize lysis conditions for mitochondrial membrane proteins.

    • Immunofluorescence: Use paraformaldehyde fixation (2%) with glutaraldehyde (2%) in sodium cacodylate buffer for optimal preservation .

    • Flow cytometry: Combine with mitochondrial markers for quantitative analysis.

  • Alternative Detection Strategies:

    • Tagged recombinant proteins (GFP-FUNDC1 or FLAG-FUNDC1) for tracking in cell culture.

    • Generate FUNDC1-RFP knockin chickens similar to XCR1-RFP birds for in vivo visualization .

How should I optimize protein extraction protocols for mitochondrial membrane proteins like FUNDC1?

Extracting mitochondrial membrane proteins requires specialized protocols:

  • Mitochondrial Isolation:

    • Begin with gentle tissue homogenization in isotonic buffer.

    • Perform differential centrifugation to isolate crude mitochondrial fraction.

    • Further purify mitochondria using density gradient centrifugation.

  • Membrane Protein Solubilization:

    • Use mild detergents for initial solubilization:

      • Digitonin (0.5-1%) for native complex preservation

      • n-Dodecyl β-D-maltoside (DDM, 1%) for efficient extraction

      • CHAPS (1%) for maintaining protein-protein interactions

    • Avoid harsh detergents like SDS that may denature the protein.

  • Buffer Optimization:

    • Include protease inhibitors to prevent degradation.

    • Add phosphatase inhibitors to preserve phosphorylation status.

    • Maintain physiological pH (7.2-7.4) during extraction.

    • Consider including glycerol (10%) to stabilize protein structure.

  • Quality Control:

    • Assess mitochondrial purity using markers for different cellular compartments.

    • Verify protein integrity by Western blotting.

    • Evaluate functional activity if applicable.

What experimental models can I use to study chicken FUNDC1 in the context of hypoxia response?

Several experimental models are suitable for studying chicken FUNDC1 in hypoxia:

  • In Vitro Cell Culture Models:

    • Primary chicken myoblasts isolated from E18 embryos .

    • Established chicken cell lines (DF-1, LMH, or HD11).

    • Hypoxic chamber setup with 1% O₂/5% CO₂/94% N₂ .

    • Chemical hypoxia mimetics (CoCl₂, DMOG) as alternatives to hypoxic chambers.

  • Ex Vivo Tissue Models:

    • Fresh tissue explants maintained in controlled oxygen conditions.

    • Precision-cut tissue slices for short-term studies.

    • Organ culture systems with controllable oxygen tension.

  • In Vivo Models:

    • Embryonic development models (eggs incubated under hypoxic conditions).

    • Post-hatch chickens with induced systemic or local hypoxia.

    • FUNDC1 knockin/knockout chickens generated via CRISPR-Cas9 .

    • Woody breast myopathy as a natural model of mitochondrial dysfunction .

  • Model Validation and Monitoring:

    • Use hypoxia-responsive genes (HIF-1α targets) as positive controls.

    • Monitor mitochondrial parameters (membrane potential, ROS production).

    • Track metabolic shifts characteristic of hypoxia (glycolysis upregulation).

Why might I observe discrepancies between FUNDC1 mRNA and protein levels in chicken tissues?

Several factors may contribute to discrepancies between mRNA and protein levels:

  • Post-transcriptional Regulation:

    • FUNDC1 mRNA may be subject to microRNA-mediated repression.

    • RNA binding proteins might affect mRNA stability and translation efficiency.

    • Alternative splicing could generate transcript variants with different stability or translation efficiency.

  • Post-translational Regulation:

    • FUNDC1 is known to undergo ubiquitylation and degradation by MARCH5 in mammals .

    • Proteasomal degradation rates may vary between tissues or conditions.

    • Tissue-specific post-translational modifications may affect antibody recognition.

  • Technical Considerations:

    • Extraction efficiency differences between RNA and protein isolation protocols.

    • Antibody sensitivity and specificity issues, particularly with chicken proteins.

    • Different half-lives of mRNA versus protein.

  • Experimental Approach to Resolve Discrepancies:

    • Measure protein synthesis and degradation rates using pulse-chase experiments.

    • Inhibit protein degradation pathways to assess turnover contribution.

    • Examine polysome association to determine translation efficiency.

    • Verify results using multiple antibodies or epitope tags.

How can I distinguish between FUNDC1-mediated mitophagy and other mitophagy pathways in chicken cells?

Differentiating between various mitophagy pathways requires specific experimental strategies:

  • Genetic Approaches:

    • Generate FUNDC1 knockout cells using CRISPR-Cas9 gene editing.

    • Compare with knockouts of other mitophagy receptors (BNIP3, NIX).

    • Use complementation experiments with wild-type or mutant FUNDC1.

  • Biochemical Differentiation:

    • FUNDC1-mediated mitophagy is specifically enhanced by dephosphorylation during hypoxia .

    • Use phospho-specific antibodies to track FUNDC1 activation.

    • Inhibit specific kinases (CK2, Src) that regulate FUNDC1 phosphorylation.

  • Experimental Triggers:

    • FUNDC1 responds primarily to hypoxia .

    • PINK1/Parkin responds to mitochondrial membrane depolarization (CCCP treatment).

    • Compare mitophagy induction between hypoxia and CCCP to distinguish pathways.

  • Interaction Analysis:

    • Examine FUNDC1-LC3 interaction using co-immunoprecipitation or proximity ligation assays.

    • Assess DRP1 and OPA1 involvement, which specifically interact with FUNDC1 .

    • Compare with markers of other mitophagy pathways.

How does chicken FUNDC1 compare evolutionarily to FUNDC1 in other species?

Evolutionary comparison of FUNDC1 across species reveals important insights:

  • Phylogenetic Distribution:

    • The FUN14 domain-containing protein family is present in eukaryotes, archaea, and bacteria .

    • Vertebrates typically have two paralogous subfamilies: FUNDC1 and FUNDC2 .

    • Some lineages, like amphibians, only contain FUNDC1 and lack FUNDC2 .

  • Evolutionary Selection Patterns:

    • FUNDC1 shows higher substitution rates in mammals compared to fishes .

    • This contrasts with BNIP3/NIX, which show higher substitution rates in fishes .

    • These patterns may reflect adaptation to changing atmospheric oxygen during vertebrate evolution from water to land .

  • Functional Domain Conservation:

    • The LIR motif for LC3 binding shows variable conservation across species.

    • FUNDC1 in land vertebrates acquired additional phosphorylation regulation layers absent in fishes .

    • Comparative analysis suggests FUNDC1's structure in land vertebrates reflects adaptation to terrestrial oxygen levels .

  • Experimental Approach for Comparative Studies:

    • Perform multiple sequence alignments across diverse species.

    • Generate phylogenetic trees to visualize evolutionary relationships.

    • Express recombinant FUNDC1 from multiple species to compare functional properties.

    • Use chimeric proteins to identify species-specific functional domains.

What are the key differences between FUNDC1 and other mitophagy receptors (BNIP3 and NIX) in chicken cells?

Understanding the distinctions between chicken mitophagy receptors is crucial:

  • Structural Differences:

    • FUNDC1 contains a FUN14 domain, while BNIP3 and NIX contain BNIP3 domains .

    • These domain differences likely contribute to unique regulatory mechanisms.

    • All three contain LIR motifs for LC3 binding but with different binding affinities .

  • Regulation Mechanisms:

    • BNIP3 and NIX are transcriptionally upregulated by HIF-1α during hypoxia .

    • FUNDC1 is constitutively expressed but regulated post-translationally .

    • FUNDC1 is downregulated during hypoxia-induced mitophagy, unlike BNIP3 and NIX .

  • Evolutionary Considerations:

    • BNIP3 domain-containing proteins are found only in animals .

    • FUN14 domain-containing proteins have broader distribution across living organisms .

    • BNIP3 and NIX gained LC3-binding ability earlier (in early invertebrates) than FUNDC1 (during early vertebrate evolution) .

  • Functional Comparison:

    • Dephosphorylated FUNDC1 shows much stronger binding to LC3 than NIX .

    • FUNDC1 uniquely interfaces with mitochondria-ER contact sites .

    • These differences suggest complementary rather than redundant roles.

What are emerging research areas for chicken FUNDC1 beyond mitophagy?

Beyond its established role in mitophagy, several promising research directions for chicken FUNDC1 include:

  • Developmental Biology:

    • Investigating FUNDC1's role during chicken embryonic development.

    • Examining tissue-specific expression patterns throughout development.

    • Studying the relationship between hypoxic niches and FUNDC1 function during organogenesis.

  • Metabolic Adaptation:

    • Exploring FUNDC1's contribution to metabolic switching during hypoxia.

    • Examining cross-talk between mitophagy and metabolism in highly metabolic tissues.

    • Investigating potential roles in seasonal or environmental adaptations.

  • Disease Models:

    • Further characterizing FUNDC1's involvement in woody breast myopathy .

    • Examining potential roles in avian cardiovascular and neurodegenerative conditions.

    • Exploring connections to inflammation and immune responses.

  • Agricultural Applications:

    • Developing genetic markers based on FUNDC1 for selecting birds with better stress tolerance.

    • Investigating environmental factors that influence FUNDC1 function and mitochondrial health.

    • Exploring interventions targeting FUNDC1 to improve poultry health and production.

How can advanced techniques like proteomics and metabolomics enhance our understanding of chicken FUNDC1?

Integrating multi-omics approaches can provide comprehensive insights into FUNDC1 function:

  • Proteomics Applications:

    • Proximity-dependent biotin identification (BioID) to map the FUNDC1 interactome.

    • Phosphoproteomics to identify novel regulatory sites and kinase networks.

    • Quantitative proteomics comparing wild-type and FUNDC1-deficient cells under hypoxia.

    • Cross-linking mass spectrometry to characterize protein-protein interaction interfaces.

  • Metabolomics Approaches:

    • Track metabolic shifts associated with FUNDC1-mediated mitophagy.

    • Compare metabolite profiles between normal and FUNDC1-deficient cells during hypoxia.

    • Identify metabolic signatures of mitochondrial dysfunction in relation to FUNDC1 activity.

    • Integrate with flux analysis to understand dynamic metabolic changes.

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data for systems-level understanding.

    • Perform pathway enrichment analysis to identify processes beyond mitophagy.

    • Develop predictive models of FUNDC1's role in cellular homeostasis.

    • Correlate molecular changes with physiological outcomes at the organismal level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.