Recombinant Chicken G protein-activated inward rectifier potassium channel 1 (KCNJ3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken G Protein-Activated Inward Rectifier Potassium Channel 1 (KCNJ3)

Recombinant Chicken G protein-activated inward rectifier potassium channel 1, also known as KCNJ3, is a protein expressed in E. coli and fused to an N-terminal His tag . KCNJ3 belongs to the G protein-coupled inwardly rectifying potassium (GIRK/Kir3) channels family, which includes at least five members: Kir3.1 to Kir3.5 . To form functional heteropolymers, Kir3.1 must combine with Kir3.2, Kir3.4, or Kir3.5 .

Synonyms:

  • GIRK1

  • G protein-activated inward rectifier potassium channel 1

  • GIRK-1

  • Inward rectifier K(+) channel Kir3.1

  • Potassium channel, inwardly rectifying subfamily J member 3

Basic Information of KCNJ3

PropertyDescription
Protein NameInward rectifier potassium channel 3
Gene NameKCNJ3
AliasesKir3.1
OrganismChicken , Homo sapiens (Human)
UniProt IDQ90854 , P48549
Transmembrane Times2
Length (aa)492 (Chicken) , 501 (Human)
SourceE. coli
TagHis
Protein LengthFull Length (1-492)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ (default final concentration of glycerol is 50%)

Gene Information

The human KCNJ3 gene, containing three exons separated by two introns, has been mapped to chromosome 2q24.1 .

Structure and Function

KCNJ3, like other members of the Kir family, consists of two transmembrane helix domains (M1 and M2), an ion-selective P-loop between M1 and M2, and cytoplasmic N- and C-terminal domains . KCNJ3 is widely expressed in different tissues and cells, including cardiac atrial myocytes and various neuronal cells, where it functions as a G-protein effector in the plasma membrane and regulates cellular excitability and activity via neurotransmitters and hormones .

GIRKs, including KCNJ3, have diverse physiological roles, such as regulating heartbeat, reward mechanisms, learning and memory functions, blood platelet aggregation, insulin secretion, and lipid metabolism .

Physiological Roles

KCNJ3 plays a vital role in various physiological processes :

  • Regulation of Heartbeat: KCNJ3 is involved in regulating heart rate. Mutations in KCNJ3 have been identified as a novel causative gene for hereditary bradyarrhythmias .

  • Reward Mechanisms, Learning, and Memory Functions: As a member of the GIRK channel family, KCNJ3 contributes to these neurological functions .

  • Blood Platelet Aggregation, Insulin Secretion, and Lipid Metabolism: KCNJ3 participates in these essential metabolic processes .

  • Maintenance of Resting Membrane Potential: Inward rectifier channels, including KCNJ3, are crucial in stabilizing the resting membrane potential and regulating potassium levels, which are essential for cellular function and excitability .

KCNJ3 Mutations and Bradyarrhythmias

Genetic mutations in KCNJ3 and KCNJ5 could predispose individuals to sinus node dysfunction and atrial fibrillation (AF) . One missense mutation in KCNJ3 (c.247A>C, p.N83H) segregates with bradyarrhythmias, and functional analysis indicates a gain-of-function of the IKACh channel .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KCNJ3; GIRK1; G protein-activated inward rectifier potassium channel 1; GIRK-1; Inward rectifier K(+ channel Kir3.1; Potassium channel, inwardly rectifying subfamily J member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MSALRRKLGDEYQVVSTSASGGGLPPPRAAPRGKRQRFVDKNGRCNVQHGNLGGETSRYL SDLFTTLVDLKWRWNLFIFVLTYTVAWLFMASMWWVIAYMRGDLNKAHDDSYTPCVANVY NFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCMFIKMSQPK KRAETLMFSEHAAISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQ LELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRTMQTEQFEIVVILEGIVETTGM TCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMS SPLIAPAVSNSKERNNSVECLDGLDEVGIKLPSKLQKITGRDDFPKKLLRISSTTSEKAY SMGDLPMKLQRISSVPGNSEEKLVSKATKMMSDPMSQSVADLPPKLQKLSGGGRMEGNLP PKLRKMNSDRFT
Uniprot No.

Target Background

Function

This G protein-activated inward rectifier potassium channel (KCNJ3) from chicken exhibits characteristics of inward rectification, favoring potassium influx over efflux. Its voltage dependence is modulated by extracellular potassium concentration; increased extracellular potassium shifts the channel activation voltage to more positive potentials. Inward rectification is primarily due to internal magnesium ion blockage. This receptor plays a vital role in cardiac rhythm regulation.

Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ3 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of chicken KCNJ3?

Chicken KCNJ3 (also known as GIRK1) is a G protein-activated inward rectifier potassium channel consisting of 492 amino acids. The full sequence includes characteristic transmembrane domains and pore regions typical of inwardly rectifying potassium channels. Functionally, KCNJ3 combines with other subunits (particularly KCNJ5/Kir3.4) to form the acetylcholine-activated potassium channel (IKACh) that regulates cardiac rhythmicity, particularly in atrial tissue . The channel is activated by G protein-coupled receptors and plays crucial roles in controlling membrane excitability and potassium homeostasis.

How does chicken KCNJ3 differ from mammalian orthologs?

Chicken KCNJ3 maintains the core functional domains of mammalian orthologs but exhibits species-specific amino acid variations that may affect channel kinetics, regulation, and pharmacological responses. Despite these differences, the chicken KCNJ3 protein shares significant homology with human and other mammalian KCNJ3 proteins, making it a valuable comparative model for evolutionary and functional studies. Researchers should note that while core channel functions are conserved, species-specific differences may influence experimental outcomes when extrapolating to human applications .

What post-translational modifications are important for KCNJ3 function?

The function of KCNJ3 channels is regulated by several post-translational modifications including phosphorylation, ubiquitination, and glycosylation. Phosphorylation by protein kinases can modulate channel gating properties and surface expression. To study these modifications in recombinant systems, researchers should consider specialized expression systems that maintain appropriate post-translational processing machinery. When using E. coli-expressed recombinant proteins (as in the commercially available products), researchers should be aware that certain modifications present in native channels may be absent .

What expression systems are optimal for functional studies of recombinant chicken KCNJ3?

  • E. coli: High protein yield, suitable for structural studies, but lacks post-translational modifications

  • Mammalian cells: Provides native-like processing and assembly, ideal for functional studies

  • Xenopus oocytes: Excellent for electrophysiological characterization due to large size and minimal endogenous channel expression

What are the critical considerations for maintaining protein stability during purification?

The stability of recombinant KCNJ3 during purification requires careful attention to buffer composition and handling procedures. For the commercially available recombinant chicken KCNJ3:

  • The protein is supplied as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

  • Repeated freeze-thaw cycles should be avoided to prevent protein degradation

  • Working aliquots should be stored at 4°C for no longer than one week

How can researchers verify the functional integrity of recombinant KCNJ3 after purification?

Verifying functional integrity of purified KCNJ3 requires multiple complementary approaches:

  • Electrophysiological studies: Reconstitution in lipid bilayers or expression in heterologous systems followed by patch-clamp recording to verify channel conductance, rectification properties, and G-protein sensitivity

  • Ligand binding assays: Using fluorescently labeled ligands or binding partners to confirm preserved binding sites

  • Structural integrity assessment: Circular dichroism spectroscopy to confirm proper protein folding

  • Co-immunoprecipitation: To verify interactions with known binding partners like Gβγ subunits

  • Western blotting: To confirm protein size and integrity, particularly important when studying His-tagged proteins to verify tag presence

How is the KCNJ3 gene organized in the chicken genome?

The chicken KCNJ3 gene is part of the broader potassium channel gene family in the chicken genome. While specific details about its chromosomal location aren't provided in the search results, the chicken genome has been extensively mapped using high-density SNP-based linkage maps . The consensus linkage map of the chicken genome spans 3228 cM and consists of 34 linkage groups covering at least 29 of the 38 autosomes. Understanding the genomic context of KCNJ3 can be important for studies involving genetic manipulation or analyzing expression regulation .

What genomic techniques are most effective for studying KCNJ3 variants in chickens?

Several genomic techniques have proven effective for studying potassium channel variants in chickens:

  • High-density SNP genotyping: Using platforms like the 600K Affymetrix Chicken SNP array to identify variants associated with specific phenotypes

  • Genome-wide association studies (GWAS): For identifying genetic loci associated with traits that might be influenced by KCNJ3 function

  • Whole exome sequencing: Particularly useful for identifying coding variants in KCNJ3 that might affect channel function

  • Linkage analysis: For mapping inheritance patterns of KCNJ3 variants in chicken populations

  • Targeted resequencing: As demonstrated in human studies of KCNJ3 and KCNJ5, this approach can efficiently identify rare variants in specific genes

How do polymorphisms in chicken KCNJ3 correlate with physiological traits?

While the search results don't specifically address polymorphisms in chicken KCNJ3, research on related potassium channels (like KCNJ8) has shown associations with traits such as eggshell ultrastructure . Similarly, in humans, KCNJ3 mutations have been linked to cardiac arrhythmias . Researchers investigating chicken KCNJ3 polymorphisms should consider:

  • Correlating genetic variations with electrophysiological parameters in cardiac tissue

  • Examining associations between KCNJ3 variants and heart rate variability

  • Investigating potential impacts on neuronal excitability, as GIRK channels also play important roles in the nervous system

  • Using statistical approaches like those employed for other chicken genes to estimate the genetic variance explained by KCNJ3 polymorphisms

What electrophysiological protocols yield optimal results for KCNJ3 functional characterization?

Optimal electrophysiological characterization of KCNJ3 channels requires specialized protocols:

  • Whole-cell patch clamp: Using voltage ramp protocols (typically from -120 mV to +40 mV) to assess inward rectification

  • Co-expression systems: KCNJ3 should be co-expressed with KCNJ5 to form functional IKACh channels, as seen in cardiac studies

  • G-protein modulation: Protocols should include assessment of channel responses to G-protein activators (like GTPγS) and muscarinic receptor agonists (acetylcholine, carbachol)

  • Single-channel recordings: To characterize unitary conductance and open probability

  • Pharmacological profiling: Include selective blockers like NIP-151 to confirm channel identity

How can researchers effectively incorporate KCNJ3 into heterologous expression systems?

Effective incorporation of recombinant chicken KCNJ3 into heterologous expression systems requires:

  • Optimized expression vectors: Using vectors with strong promoters appropriate for the host cell type

  • Codon optimization: Adapting the chicken KCNJ3 sequence for optimal expression in mammalian or insect cells

  • Co-transfection strategies: Co-expressing with KCNJ5/Kir3.4 and relevant G proteins to reconstitute functional complexes

  • Membrane targeting signals: Verifying appropriate trafficking to the plasma membrane using fluorescent tags or surface biotinylation

  • Expression verification: Western blotting using antibodies against the His-tag or KCNJ3 protein to confirm expression

What are the technical challenges in reconstituting functional KCNJ3 channels in artificial membranes?

Reconstituting functional KCNJ3 channels in artificial membranes presents several technical challenges:

  • Protein preparation: The protein must maintain its native conformation during purification and reconstitution

  • Membrane composition: Lipid composition significantly affects channel function; including PIP2 is crucial as it's a cofactor for channel activation

  • Channel orientation: Ensuring uniform orientation of channels in the membrane

  • Partner proteins: KCNJ3 typically requires KCNJ5 and G-proteins for full functionality

  • Stability: Maintaining a stable recording environment for extended measurements

  • Verification: Confirming channel identity through pharmacological approaches (e.g., barium sensitivity and response to G-protein regulators)

How do mutations in KCNJ3 contribute to cardiac arrhythmias and other pathologies?

Mutations in KCNJ3 have significant implications for cardiac electrophysiology and pathology:

  • The human KCNJ3 mutation c.247A>C (p.N83H) has been identified as a cause of hereditary bradyarrhythmias, including sinus node dysfunction, atrial fibrillation with slow ventricular response, and atrioventricular block

  • This mutation causes a gain of IKACh channel function by increasing the basal current, even without muscarinic receptor stimulation

  • Additional rare mutations in both KCNJ3 and KCNJ5 have been found in patients with sporadic atrial fibrillation

  • The mechanisms involve altered channel gating properties, leading to enhanced potassium currents that hyperpolarize cardiac cells and slow conduction

What animal models are most appropriate for studying KCNJ3 function?

Several animal models have proven valuable for studying KCNJ3 function:

  • Zebrafish models: Transgenic zebrafish expressing mutant human KCNJ3 in the atrium have successfully recapitulated bradyarrhythmia phenotypes

  • Mouse models: Knockout and knock-in models have been used extensively for potassium channel research

  • Chicken embryo models: Accessible for developmental studies of cardiac function

  • Cell-based models: Patient-derived induced pluripotent stem cells (iPSCs) differentiated into cardiomyocytes

The choice of model depends on the specific research question:

  • Zebrafish are excellent for high-throughput screening of compounds affecting channel function

  • Mammalian models provide closer physiological relevance to human conditions

  • Avian models offer advantages for developmental studies

How can pharmacological modulation of KCNJ3 be leveraged for therapeutic development?

The pharmacological modulation of KCNJ3 channels offers promising therapeutic avenues:

  • Selective IKACh channel blockers like NIP-151 have been shown to repress increased current and improve bradyarrhythmia phenotypes in animal models with KCNJ3 mutations

  • Such compounds represent potential non-invasive alternatives to pacemaker implantation for treating certain bradyarrhythmias

  • For research purposes, pharmacological tools can help distinguish KCNJ3-containing channels from other potassium channels

  • Structure-activity relationship studies using recombinant chicken KCNJ3 can inform the development of species-specific channel modulators

The development pipeline should include:

  • In vitro screening using recombinant channels

  • Validation in heterologous expression systems

  • Testing in animal models like the transgenic zebrafish

  • Evaluation of specificity against other potassium channels

How do species-specific differences in KCNJ3 structure inform evolutionary adaptations in cardiac function?

Comparative analysis of KCNJ3 across species provides insights into evolutionary adaptations in cardiac function:

  • Chicken KCNJ3, with its 492 amino acid sequence , can be compared with mammalian orthologs to identify conserved and divergent regions

  • Differences in channel properties may correlate with species-specific heart rates and cardiac physiologies

  • Cross-species functional studies can reveal how evolutionary pressure has shaped channel kinetics

  • The full amino acid sequence available from recombinant protein resources enables detailed structural comparisons

What are the emerging techniques for studying KCNJ3 channel dynamics at the molecular level?

Several cutting-edge techniques are advancing our understanding of KCNJ3 channel dynamics:

  • Cryo-electron microscopy: For high-resolution structural determination of channel complexes in different conformational states

  • Single-molecule FRET: To visualize real-time conformational changes during channel gating

  • Molecular dynamics simulations: Using the full sequence information to model channel behavior in different membrane environments

  • Optogenetic approaches: Combining light-sensitive domains with KCNJ3 for precise temporal control of channel function

  • CRISPR/Cas9 genome editing: For introducing specific mutations to study structure-function relationships

How might KCNJ3 research contribute to personalized medicine approaches for cardiac arrhythmias?

KCNJ3 research has significant implications for personalized medicine:

  • Genetic screening for KCNJ3 mutations in patients with unexplained bradyarrhythmias could identify candidates for targeted therapies

  • The development of selective IKACh channel modulators offers potential alternatives to invasive pacemaker implantation for patients with specific genotypes

  • Understanding how different mutations affect channel function can inform predictive models of disease progression and treatment response

  • Pharmacogenomic approaches could optimize drug selection based on a patient's specific KCNJ3 variant

  • The translational pathway established in zebrafish models demonstrates how channel-specific compounds (like NIP-151) can be rapidly evaluated for therapeutic potential

What approaches are most effective for studying KCNJ3 interactions with regulatory proteins?

Studying KCNJ3 interactions with regulatory proteins requires specialized approaches:

  • Co-immunoprecipitation: Using His-tagged recombinant KCNJ3 to pull down interaction partners

  • Proximity labeling: BioID or APEX2 fusion proteins to identify the channel interactome

  • FRET/BRET assays: For real-time monitoring of protein-protein interactions in living cells

  • Surface plasmon resonance: To determine binding kinetics between purified KCNJ3 and regulatory proteins

  • Yeast two-hybrid screening: To discover novel interaction partners

Researchers should focus on known regulators including:

  • G-protein βγ subunits

  • Regulator of G-protein signaling (RGS) proteins

  • PIP2 and lipid interactions

  • Scaffolding proteins that organize channel complexes

How can computational approaches enhance understanding of KCNJ3 structure-function relationships?

Computational approaches offer powerful tools for understanding KCNJ3:

  • Homology modeling: Using the full-length amino acid sequence to predict structural features

  • Molecular dynamics simulations: To study channel behavior in membrane environments

  • Protein-protein docking: To predict interactions with regulatory proteins

  • Machine learning approaches: For identifying patterns in channel responses to mutations or pharmacological agents

  • Systems biology modeling: To integrate channel function into broader cellular signaling networks

These approaches can predict:

  • Effects of mutations on channel function

  • Binding sites for pharmacological agents

  • Conformational changes during gating

  • Interactions with lipids and regulatory proteins

What considerations are important when comparing results between recombinant KCNJ3 and native channels?

Researchers must consider several factors when comparing recombinant and native KCNJ3 channels:

  • Subunit composition: Native IKACh channels are heterotetramers of KCNJ3 and KCNJ5, whereas recombinant systems may contain homotetramers or controlled heteromers

  • Post-translational modifications: E. coli-expressed recombinant KCNJ3 lacks mammalian-type modifications

  • Regulatory environment: Native channels exist in complex macromolecular complexes with scaffolding and regulatory proteins

  • Membrane composition: Lipid environments differ between artificial systems and native membranes

  • Species differences: Chicken KCNJ3 may have functional differences from mammalian orthologs

To bridge these gaps:

  • Use native tissue controls alongside recombinant systems

  • Compare electrophysiological parameters systematically

  • Consider reconstitution of regulatory components

  • Account for species-specific differences in interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.