Recombinant Chicken Gap junction alpha-1 protein (GJA1)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

ParameterSpecification
Expression systemEscherichia coli (E. coli)
TagN-terminal His-tag for purification
Purity>90% (SDS-PAGE verified)
ReconstitutionPBS (pH 7.4) at 0.1–1.0 mg/mL
Storage-80°C long-term; 2–8°C for <1 month

Buffer composition:

  • 0.01% Sarcosyl

  • 1 mM DTT

  • 5% Trehalose

  • Proclin-300 preservative

Cellular Communication Studies

  • Quantification via ELISA (detection range: 15.6–1,000 pg/mL)

  • Localization analysis at intercalated disks in cardiomyocytes

Genetic Association Studies

Four SNPs in chicken GJA1 show significant correlations with growth traits :

SNP IDLocationAssociated Traits
c.-1110 C>TExon (synonymous)Body weight, breast muscle depth
c.5460 A>CIntronTibia length, shank girth
c.5589 T>AIntronFeed conversion ratio
c.6260 A>CPromoterGrowth rate across developmental stages

Haplotype effects:

  • Diplotype CC+CC associates with superior growth performance

  • Commercial breeds show reduced genetic diversity compared to indigenous populations

Disease Relevance

While primarily studied in chickens, structural analogs in mammals demonstrate:

  • Cardiac conduction abnormalities when dysfunctional

  • Skin disorders (e.g., erythrokeratodermia) from impaired membrane localization

  • Developmental defects in oculodentodigital dysplasia models

Technical Performance Data

ELISA kit validation (Chicken samples):

ParameterResult
Intra-assay CV<8%
Inter-assay CV<10%
Recovery rate85–115%
LinearityR² > 0.99

Western blot compatibility:

  • Detects both natural and recombinant protein

  • Recommended dilution: 1:500–1:2,000

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development if possible.
Synonyms
GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-381
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKREEELKVVQNDGV NVDMHLKQIESKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAIYTCERDPCPHRVDCFLSRPTEKTIFIVFMLVVSLVSLALNIIELFYVFFKGVKDRVK GKTDPYSHSGTMSPSKDCGSPKYAYYNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYN KQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFADEHQNTKKLASGHELQPLTIVDQR PPSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function
Gap junctions are formed by clusters of closely packed pairs of transmembrane channels known as connexons. These channels facilitate the diffusion of low molecular weight materials between adjacent cells. Chicken Gap junction alpha-1 protein (GJA1) plays a crucial role in gap junction communication within the ventricles.
Gene References Into Functions
  1. This study identifies four novel SNPs, four haplotypes from two variants exhibiting high linkage disequilibrium, and seven diplotypes of the chicken GJA1 gene. These findings reveal a significant association between these genetic variations and growth traits. PMID: 26782534
  2. Fluid flow shear stress triggers the translocation of Cx43 to the cell membrane surface. Unapposed hemichannels formed by Cx43 function as a novel pathway for the release of PGE2 in response to mechanical strain. PMID: 15843434
  3. Mechanotransduction occurs within individual cells, but signal integration significantly enhances this process. Communication via connexin 43 is inhibitory. PMID: 16859807
  4. Four percent of tenocytes exhibited colocalization of actin filaments and Cx43. This colocalization was significantly increased with 5% cyclic strain. PMID: 17183550
  5. Cell-cell communication between osteocytes in chick calvaria was mediated by Cx43 and was regulated by extracellular pH, extracellular calcium ion concentration, and PTH. PMID: 17997713
  6. Cx43-hemichannel activity associated with PGE(2) release is adaptively regulated by mechanical loading, providing an effective mechanism for controlling levels of extracellular signaling molecules involved in initiating bone (re)modeling. PMID: 18676366

Show More

Hide All

Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
In all tissues, but mostly in lens.

Q&A

What is Gap Junction Alpha-1 Protein (GJA1) and what is its significance in chicken developmental biology?

Gap Junction Alpha-1 Protein (GJA1), also known as connexin 43 (CX43), functions as a critical component of gap junctions, forming transport channels across cell membranes. In chickens, GJA1 is the most commonly expressed gap junction subunit and plays essential roles in multiple developmental processes. The protein contains four transmembrane domains with five linked subdomain loops, including two extracellular subdomains and three cytoplasmic loops (including the N- and C-terminal domains) . The significance of GJA1 in chicken developmental biology stems from its involvement in growth regulation, muscle development, and intercellular communication. Research has shown that GJA1 polymorphisms significantly affect growth traits in chickens, suggesting it either functions as or is associated with a major gene impacting chicken growth and development .

What are the primary functions of GJA1 in chicken tissues?

GJA1 performs several critical functions in chicken tissues:

  • Intercellular communication through gap junctions, allowing the diffusion of low molecular weight materials between cells

  • Regulation of growth traits and muscle development in various chicken breeds

  • Maintenance of motile cilia structure and function, similar to what has been observed in other vertebrate systems

  • Modulation of cell extension, migration, and polarity through its C-terminal domain

  • Interaction with cytoskeletal networks, including both actin and tubulin components

The protein's expression varies across different chicken tissues, with particularly important roles in developing muscle, heart, and embryonic tissues. Research indicates that GJA1 polymorphisms significantly affect multiple growth traits in chickens, suggesting a central role in regulating developmental processes .

How do SNPs in the chicken GJA1 gene influence growth traits, and what are the implications for selective breeding programs?

Single nucleotide polymorphisms (SNPs) in the chicken GJA1 gene show significant associations with multiple growth traits. Research has identified four key variants in the chicken GJA1 gene: one synonymous mutation in an exon (C61223231T or c.-1110 C>T), two in intron regions (A61229799C or c.5460 A>C, T61229928A or c.5589 T>A), and one in the promoter region (A61230599C or c.6260 A>C) . Association analysis revealed that each of these SNPs significantly influences growth traits in chickens.

Particularly notable is the strong linkage disequilibrium observed between the C61223231T and A61229799C polymorphisms, which formed four previously undiscovered haplotypes (CA, TC, CC, TA). When these haplotypes were analyzed as combinations (diplotypes), they showed highly significant associations with growth traits, with the CC+CC diplotype demonstrating dominance across all measured traits .

These findings have profound implications for selective breeding programs. By genotyping for these specific polymorphisms, breeders could potentially select for chickens with superior growth characteristics. The higher genetic diversity observed in indigenous breeds like Beijing-You (BJY) compared to commercial Cobb broiler (CB) breeds also suggests that there may be untapped genetic resources in traditional breeds that could be leveraged for improved commercial lines .

What mechanisms underlie GJA1's role in ciliogenesis, and how might these be experimentally manipulated in chicken models?

GJA1 plays a crucial role in ciliogenesis through multiple mechanisms, primarily through its interaction with the Rab11-Rab8 ciliary trafficking pathway. Studies have shown that GJA1 localizes to motile ciliary axonemes or pericentriolar regions beneath the primary cilium . When GJA1 is depleted, both primary and motile cilia exhibit malformations, indicating its essential role in proper cilia formation and function.

Mechanistically, GJA1 depletion affects several key ciliary proteins including BBS4, CP110, and Rab11 in the pericentriolar region and basal body. One particularly important observation is that CP110 removal from the mother centriole is significantly reduced when GJA1 is depleted. Additionally, co-immunoprecipitation studies have demonstrated that Rab11, a key regulator of ciliogenesis, directly interacts with GJA1, and GJA1 knockdown results in Rab11 mislocalization .

To experimentally manipulate these mechanisms in chicken models, researchers could:

  • Use siRNA or CRISPR-Cas9 approaches to selectively knock down or knock out GJA1 in chicken embryonic cells

  • Create expression constructs for wild-type and mutant forms of GJA1 to evaluate functional domains

  • Utilize immunofluorescence techniques to monitor the localization of GJA1 and its partner proteins during ciliogenesis

  • Employ co-immunoprecipitation assays to identify chicken-specific interaction partners of GJA1

  • Develop primary chicken cell culture models that promote ciliogenesis for in vitro manipulation

These approaches would help elucidate the specific molecular mechanisms by which GJA1 regulates ciliogenesis in chicken models, potentially revealing novel therapeutic targets for ciliopathies across species.

What is the relationship between GJA1 phosphorylation states and its functional properties in chicken tissues?

While specific data on chicken GJA1 phosphorylation is limited in the provided search results, insights can be drawn from studies on related connexin proteins in chickens. Research on connexin56 in chicken lens tissue has demonstrated that connexins exist in multiple phosphorylated forms, as evidenced by multiple immunoreactive bands on immunoblots that collapse to fewer bands after alkaline phosphatase treatment .

By analogy, GJA1 likely undergoes similar post-translational modifications in chicken tissues. The phosphorylation state of connexins typically regulates:

  • Assembly and disassembly of gap junction channels

  • Channel gating properties, including permeability and selectivity

  • Protein trafficking and membrane insertion

  • Protein half-life and degradation pathways

  • Interactions with regulatory and structural proteins

The phosphorylation patterns may differ between tissue regions and developmental stages, as seen with connexin56 in chicken lens where patterns differed between nuclear and cortical regions . Additionally, phosphorylation states likely change during embryonic development, potentially reflecting the maturation of gap junction communication networks.

Future research should specifically investigate GJA1 phosphorylation in chicken tissues using techniques such as phospho-specific antibodies, mass spectrometry, and mutational analysis of key phosphorylation sites to determine how these modifications regulate GJA1 function in different chicken tissues and developmental contexts.

What are the optimal methods for expressing and purifying recombinant chicken GJA1 protein?

Based on research practices with connexin proteins, the optimal methods for expressing and purifying recombinant chicken GJA1 protein involve multiple strategic steps:

Expression Systems:

  • Insect cell expression systems (particularly Sf9 or High Five cells) are preferred for membrane proteins like GJA1 due to their ability to perform post-translational modifications

  • Mammalian cell systems (HEK293 or CHO) may be used when proper folding and post-translational modifications are critical

  • E. coli systems may be utilized for specific domains (particularly the cytoplasmic domains) but are generally less suitable for full-length membrane proteins

Vector Design Considerations:

  • Include a cleavable affinity tag (His6, FLAG, or GST) for purification

  • Consider using a fusion partner (such as MBP or SUMO) to improve solubility

  • Incorporate a fluorescent protein tag for tracking expression and localization if needed

Purification Strategy:

  • Solubilize membranes using detergents appropriate for gap junction proteins (typically mild non-ionic detergents like DDM or Triton X-100)

  • Utilize affinity chromatography as the initial purification step

  • Follow with size exclusion chromatography to separate properly folded protein from aggregates

  • Consider ion exchange chromatography as a final polishing step

Quality Control:

  • Verify protein identity using Western blotting with GJA1-specific antibodies

  • Assess purity using SDS-PAGE and protein staining

  • Confirm proper folding using circular dichroism spectroscopy

  • Evaluate oligomeric state using native PAGE or analytical ultracentrifugation

This systematic approach, drawing on techniques used for connexin56 in chicken lens studies , provides a framework for successful expression and purification of recombinant chicken GJA1 protein.

What genotyping methods are most effective for identifying GJA1 polymorphisms in chicken populations?

Based on successful research approaches, the most effective genotyping methods for identifying GJA1 polymorphisms in chicken populations include:

High-Resolution Melting Analysis (HRMA):
This method has proven effective for genotyping SNPs in coding regions, as demonstrated in studies of the chicken GJA1 gene . HRMA offers advantages including:

  • Rapid throughput without post-PCR handling

  • High sensitivity for detecting sequence variations

  • Cost-effectiveness for screening large populations

  • Ability to detect heterozygotes and homozygotes

DNA Sequencing:
Direct DNA sequencing remains the gold standard for identifying polymorphisms in intronic and promoter regions of the GJA1 gene . This approach provides:

  • Comprehensive identification of all sequence variations

  • Precise determination of nucleotide changes

  • Ability to detect novel, previously uncharacterized polymorphisms

  • Definitive resolution of complex haplotypes

PCR-RFLP (Restriction Fragment Length Polymorphism):
This technique can be employed for known polymorphisms that create or abolish restriction enzyme recognition sites, offering:

  • Straightforward implementation in most molecular biology laboratories

  • Cost-effective approach for known SNPs

  • Visual confirmation of genotypes on standard agarose gels

Allele-Specific PCR:
For high-throughput screening of specific, known polymorphisms, this method provides:

  • Rapid results without specialized equipment

  • Ability to multiplex for multiple SNPs simultaneously

  • Cost-effective approach for large-scale screening

The selection of genotyping method should be based on the specific research question, with HRMA and DNA sequencing being particularly valuable for comprehensive polymorphism identification in the chicken GJA1 gene .

What imaging techniques provide the most detailed insights into GJA1 localization in chicken tissues?

To achieve comprehensive visualization of GJA1 localization in chicken tissues, researchers should employ a multi-modal imaging approach:

Confocal Immunofluorescence Microscopy:
This serves as the foundation for GJA1 localization studies, as demonstrated in research on GJA1 in multiciliated cells . Key advantages include:

  • High resolution visualization of subcellular localization

  • Ability to simultaneously detect multiple proteins through co-staining

  • Capacity to generate 3D reconstructions through z-stack imaging

  • Detection of GJA1 at cell-cell junctions, in pericentriolar regions, and in ciliary axonemes

Super-Resolution Microscopy:
Techniques such as STED, STORM, or PALM provide nanoscale resolution that reveals:

  • Precise organization of GJA1 within gap junction plaques

  • Detailed structure of GJA1 in ciliary axonemes

  • Spatial relationships between GJA1 and other proteins at a resolution below the diffraction limit

Immunoelectron Microscopy:
This technique offers ultrastructural localization of GJA1, providing:

  • Nanometer-scale resolution of protein localization

  • Direct visualization of GJA1 in relation to cellular membranes and organelles

  • Confirmation of GJA1 presence in specific subcellular structures

Live Cell Imaging:
For dynamic studies of GJA1 trafficking and function:

  • Use of GFP-tagged GJA1 constructs to track protein movement in real-time

  • FRAP (Fluorescence Recovery After Photobleaching) to analyze GJA1 mobility

  • FRET (Förster Resonance Energy Transfer) to detect protein-protein interactions

As demonstrated in studies of GJA1 in Xenopus embryonic multiciliated cells and chicken tissues, these imaging approaches reveal that GJA1 localizes not only to gap junctions at cell-cell contacts but also to motile ciliary axonemes and pericentriolar regions beneath primary cilia , providing crucial insights into its diverse functional roles.

How can chicken GJA1 be manipulated to study its role in muscle development and growth traits?

Chicken GJA1 can be systematically manipulated using multiple complementary approaches to elucidate its role in muscle development and growth traits:

Genetic Manipulation Strategies:

  • CRISPR-Cas9 Genome Editing: Create targeted mutations in the chicken GJA1 gene to generate knockouts or introduce specific polymorphisms that have been associated with altered growth traits .

  • Overexpression Systems: Develop transgenic chicken models with tissue-specific promoters to drive enhanced expression of wild-type or mutant GJA1 in muscle tissues.

  • Knockdown Approaches: Utilize RNA interference (siRNA or shRNA) to reduce GJA1 expression in embryonic muscle cells or in ovo to assess developmental consequences.

Ex Vivo and In Vitro Models:

  • Primary Myoblast Cultures: Isolate myoblasts from chicken embryos of different breeds (e.g., Beijing-You and Cobb broiler) to compare GJA1 expression and function during differentiation .

  • Muscle Explant Cultures: Maintain muscle tissue explants in culture to evaluate the effects of GJA1 manipulation on muscle fiber formation and growth.

  • Embryonic Manipulation: Perform in ovo electroporation to deliver GJA1 constructs to developing muscle tissues in chicken embryos.

Functional Readouts:

  • Morphometric Analysis: Measure muscle fiber diameter, number, and organization following GJA1 manipulation.

  • Transcriptomic Profiling: Perform RNA-seq to identify genes and pathways affected by altered GJA1 expression.

  • Calcium Imaging: Assess intercellular calcium signaling as a functional readout of gap junction communication in developing muscle.

  • Proteomic Analysis: Identify GJA1 interaction partners in muscle tissue using co-immunoprecipitation followed by mass spectrometry.

Correlation with Growth Traits:

  • Genotype-Phenotype Association: Expand studies of the relationship between GJA1 polymorphisms and growth traits across diverse chicken populations .

  • Haplotype Analysis: Further investigate the functional consequences of the four haplotypes (CA, TC, CC, TA) identified in previous research, particularly the dominant CC+CC diplotype .

These approaches provide a comprehensive framework for investigating GJA1's role in muscle development and growth traits in chickens, building upon the foundation established by previous studies of GJA1 polymorphisms .

What are the most effective approaches for studying the interaction between GJA1 and the Rab11-Rab8 ciliary trafficking pathway in chicken cells?

To effectively study the interaction between GJA1 and the Rab11-Rab8 ciliary trafficking pathway in chicken cells, researchers should employ a multi-faceted approach:

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation (Co-IP): This technique has successfully demonstrated the interaction between GJA1 and Rab11 . For chicken cells, optimize antibodies specifically for chicken GJA1 and Rab11 proteins.

  • Proximity Ligation Assay (PLA): This method can detect protein interactions with spatial resolution in fixed cells, confirming direct interaction between GJA1 and components of the Rab11-Rab8 pathway.

  • FRET/BRET Analysis: These techniques can assess protein interactions in living cells, providing dynamic information about GJA1-Rab11 interactions during ciliogenesis.

Localization Studies:

  • Multi-color Immunofluorescence: Co-staining for GJA1, Rab11, Rab8, and ciliary markers in chicken cells can reveal spatial relationships during ciliogenesis .

  • Live Imaging: Using fluorescent protein-tagged constructs of GJA1, Rab11, and Rab8 to track their dynamic localization and movement during cilia formation.

  • Super-resolution Microscopy: Techniques like STED or STORM can provide nanoscale resolution of the spatial organization of these proteins at the ciliary base.

Functional Manipulation:

  • RNA Interference: Targeted knockdown of GJA1 using siRNA has been shown to cause mislocalization of Rab11 . This approach can be adapted for chicken cells to study pathway disruption.

  • Dominant-negative Constructs: Expression of dominant-negative forms of Rab11 or Rab8 to assess effects on GJA1 localization and function.

  • Pharmacological Inhibitors: Use of specific inhibitors of vesicular trafficking to dissect the pathway's components.

Ciliary Trafficking Assays:

  • Ciliary Protein Transport: Monitor the movement of ciliary cargo proteins in the presence and absence of functional GJA1.

  • Vesicle Tracking: Quantitative analysis of Rab11-positive vesicle movement in relation to GJA1 localization.

  • CP110 Removal Assay: Measure the rate of CP110 removal from mother centrioles as a readout of successful ciliogenesis initiation, which is affected by GJA1 depletion .

These approaches, building on established findings that GJA1 regulates ciliogenesis by interacting with the Rab11-Rab8 ciliary trafficking pathway , will provide a comprehensive understanding of this interaction in chicken cells.

How does the phosphorylation state of chicken GJA1 correlate with developmental changes in different tissues?

Developmental Regulation of Phosphorylation:
Similar to connexin56 in chicken lens, where levels increased from embryonic days 4 to 15 and the pattern of phosphorylated bands changed over time , GJA1 phosphorylation likely follows developmental programs specific to each tissue. The phosphorylation patterns would be expected to shift during key developmental transitions, such as:

  • Initial tissue patterning and organogenesis

  • Transition from proliferation to differentiation phases

  • Establishment of functional gap junctional communication

  • Maturation of tissue-specific functions

Tissue-Specific Phosphorylation Patterns:
Drawing from observations that connexin56 showed differential band patterns between lens nucleus and cortex regions , chicken GJA1 would likely exhibit tissue-specific phosphorylation signatures that reflect:

  • The unique kinase and phosphatase activities present in each tissue

  • Tissue-specific requirements for gap junctional communication

  • Regulatory needs related to tissue-specific functions of GJA1

  • Integration with tissue-specific signaling pathways

Analytical Approaches for Studying GJA1 Phosphorylation:
To effectively study chicken GJA1 phosphorylation across development, researchers should employ:

  • Comparative Phosphoproteomic Analysis: Using mass spectrometry to identify and quantify phosphorylation sites across developmental timepoints and tissues

  • Phosphorylation-State Specific Antibodies: Developing antibodies that recognize specific phosphorylated forms of chicken GJA1

  • 2D Gel Electrophoresis: Separating the various phosphorylated forms of GJA1 based on both molecular weight and isoelectric point

  • Phosphatase Sensitivity Assays: Treatment with alkaline phosphatase to confirm phosphorylation status, as demonstrated with connexin56

  • Kinase Inhibitor Studies: Using specific kinase inhibitors to identify the regulatory enzymes controlling GJA1 phosphorylation in each tissue

This multi-faceted approach would reveal how the phosphorylation state of chicken GJA1 correlates with and potentially regulates developmental changes across different tissues, providing insights into both basic biology and potential applications in poultry science.

What are the most promising future research directions for chicken GJA1 studies?

The investigation of chicken GJA1 presents several high-potential research avenues that could significantly advance our understanding of developmental biology, cellular communication, and poultry science:

  • Comprehensive Functional Genomics: Expanding the study of GJA1 polymorphisms across diverse chicken breeds to create a complete catalog of genetic variants and their phenotypic effects. This would build upon existing work that has identified significant associations between GJA1 variants and growth traits .

  • Ciliogenesis Regulation Mechanisms: Further elucidating the molecular pathways through which GJA1 regulates ciliogenesis in chicken cells, particularly focusing on the Rab11-Rab8 trafficking pathway interactions that have been demonstrated in other systems .

  • Tissue-Specific Conditional Knockouts: Developing chicken models with tissue-specific and temporally controlled GJA1 deletion to dissect its role in different developmental contexts without the confounding effects of embryonic lethality.

  • Interactome Mapping: Conducting comprehensive proteomic analyses to identify the complete set of GJA1 interaction partners in different chicken tissues and developmental stages, potentially revealing novel regulatory mechanisms.

  • Phosphorylation Code Deciphering: Systematically characterizing the phosphorylation patterns of GJA1 across tissues and developmental stages, similar to studies done with connexin56 , to establish a "phosphorylation code" that regulates GJA1 function.

  • Translational Applications: Leveraging knowledge of GJA1 polymorphisms for marker-assisted selection in poultry breeding programs, potentially improving growth traits and muscle development in commercial lines based on the significant associations already identified .

  • Comparative Studies Across Avian Species: Expanding GJA1 research to other avian species to understand evolutionary conservation and divergence of gap junction functions in birds.

These research directions would not only advance our fundamental understanding of gap junction biology but could also lead to practical applications in poultry breeding and potentially inform human health research on gap junction-related disorders.

How might findings from chicken GJA1 research translate to applications in both avian health and broader comparative physiology?

Findings from chicken GJA1 research have significant translational potential across multiple domains:

Poultry Health and Production:

  • Genetic Selection Programs: The strong association between GJA1 haplotypes and growth traits suggests that genetic screening for favorable GJA1 variants could enhance breeding programs . The CC+CC diplotype, which shows dominance for growth traits, represents a particularly promising genetic marker.

  • Disease Resistance: As gap junctions play roles in immune cell communication, GJA1 variants might influence susceptibility to avian pathogens, offering potential targets for improving disease resistance.

  • Developmental Robustness: Understanding GJA1's role in embryonic development could lead to interventions that reduce embryonic mortality in commercial incubation.

Comparative Physiology:

  • Evolutionary Insights: Comparing chicken GJA1 structure and function with mammalian homologs provides insights into the evolution of intercellular communication systems across vertebrates.

  • Model for Human Diseases: The role of GJA1 in ciliogenesis in chicken cells parallels mechanisms in human cells , suggesting chicken models could inform our understanding of human ciliopathies.

  • Tissue-Specific Communication: The differential expression and modification of GJA1 across tissues offers a window into how intercellular communication is tailored to tissue-specific functions across species.

Biomedical Applications:

  • Drug Development Models: Chicken systems expressing recombinant GJA1 could serve as platforms for screening compounds that modulate gap junction communication, with potential therapeutic applications.

  • Regenerative Medicine: Insights into GJA1's role in tissue development and cell differentiation could inform approaches to tissue engineering across species.

  • Ciliopathy Research: The established role of GJA1 in regulating the Rab11-Rab8 ciliary trafficking pathway provides a molecular target for investigating ciliopathies that affect both avian and mammalian species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.