Recombinant Chicken Gap junction alpha-5 protein (GJA5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJA5; Gap junction alpha-5 protein; Connexin-42; Cx42
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-369
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
GJA5
Target Protein Sequence
GDWSFLGEFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAGPLWGDEQSDFMCDTQQPGC ENVCYDKAFPISHVRFWVLQIIFVSTPSLVYMGHAMHTVRMEEKRKMKEAEREAQEMKNS GDTYYQQKCPVAEKTELSCWDESGGKIILRGSLLNTYVYSILIRTAMEIAFIVGQYILYG IFLETLYICQRAPCPHPVNCYVSRPTEKNVFIIFMLAVAVLSLFLSLAELYHLGWKKAKE RCSRAYKPSPSTAPRRLESAPQVERAQMYTPPPDFNQCLASPNGKFISPFSNKMASQQNT ANFATERVHSQEDAAGEGPFMKSSYMESPEVASECAAPALPESYFNEKRRFSKASRASSK ARSDDLSV
Uniprot No.

Target Background

Function
Gap junctions are composed of clusters of closely packed pairs of transmembrane channels, known as connexons, through which low molecular weight materials can diffuse between adjacent cells.
Database Links

STRING: 9031.ENSGALP00000024929

UniGene: Gga.863

Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Mostly in heart, and in the whole embryo, liver, stomach, and pectoral muscle.

Q&A

What is chicken GJA5 and how does it differ from other connexins?

Chicken gap junction alpha-5 protein (GJA5), also known as connexin-40 (Cx40), is a member of the connexin gene family. GJA5 forms intercellular channels that provide a pathway for the diffusion of low molecular weight substances between adjacent cells . The chicken GJA5 protein consists of 358 amino acids with four transmembrane domains, which is characteristic of connexin proteins . Unlike other connexins, GJA5 shows specific expression patterns in certain tissues and has distinct regulatory mechanisms, particularly in feather follicles where it plays a role in pigmentation patterns .

Basic Information of Chicken GJA5
Protein NameGap junction alpha-5 protein
Gene NameGJA5
AliasesConnexin-40
OrganismGallus gallus (Chicken)
Transmembrane Domains4
Length (aa)358

What are the known transcripts of chicken GJA5 and their expression patterns?

Multiple GJA5 transcripts have been identified in chickens, with at least four different transcripts that differ primarily in their untranslated exon 1 while encoding the same protein sequence . Notably, the transcript NM_205504.2 has been detected across multiple tissues, while three other transcripts (including XM_015295951.2) are primarily expressed in feather follicles . Expression levels vary significantly between phenotypes; for example, the XM_015295951.2 transcript shows approximately ninefold higher expression in Dark Cornish (Ml/Ml) chickens compared to wild-type birds . This differential expression pattern is critical when designing experiments to study specific transcripts in different chicken tissues.

How does GJA5 contribute to feather pigmentation patterns in chickens?

GJA5 plays a crucial role in determining within-feather pigmentation patterns in chickens by mediating cell-cell communications between melanocytes and other cells in the feather follicle . A mutation upstream of the GJA5 gene causes the Melanotic phenotype, which enhances the contrast between dark and light-colored regions in feathers . This cis-acting regulatory mutation affects GJA5 expression patterns, altering intercellular communication during feather development. The resulting phenotypic effect can be observed as the difference between the double-lacing pattern in Dark Cornish chickens (Ml/Ml) versus the pencilling pattern in Partridge Plymouth Rock chickens (ml+/ml+) . Researchers studying pigmentation should consider GJA5 expression when analyzing pattern formation mechanisms in avian models.

What role does GJA5 play in vascular development in chicken embryos?

In chicken embryo development, GJA5 expression is critical for arterial identity and function. Research has demonstrated that GJA5 expression correlates with arterial flow patterns—specifically pulsatile shear patterns that are characteristic of arteries . The redistribution of arterial flow through experimental vitelline artery ligation results in flow-driven collateral arterial network formation associated with increased expression of GJA5 . This mechanism appears to be evolutionarily conserved, as similar functions have been observed in mouse models where Gja5 (connexin 40) is expressed in arteries and plays a functional role in flow-driven arteriogenesis . Understanding this relationship is essential for researchers studying vascular development and arterial network formation.

What techniques are most effective for studying differential expression of GJA5 transcripts?

For studying differential expression of chicken GJA5 transcripts, a combination of quantitative RT-PCR (qRT-PCR) and allele-specific expression analysis has proven effective . To analyze tissue-specific expression patterns, researchers should:

  • Design transcript-specific primers that can distinguish between the four different GJA5 transcripts

  • Extract RNA from relevant tissues (particularly feather follicles for pigmentation studies)

  • Perform qRT-PCR using appropriate reference genes for normalization

  • For allelic imbalance studies, use heterozygous individuals (Ml/ml+) and sequence markers (such as rs313638830, rs731128040, and rs312762853) to quantify relative expression from each allele

This methodology has successfully revealed significant differences in transcript expression between genotypes, with some transcripts showing higher expression from the Ml allele and others from the wild-type allele.

How can reporter assays be optimized to investigate GJA5 regulatory mechanisms?

To investigate GJA5 regulatory mechanisms, luciferase reporter assays can be effectively utilized by following these methodological considerations:

  • Generate reporter constructs mimicking different haplotypes that include relevant polymorphisms (such as InDel1 and rs316201461 for chicken GJA5)

  • Select appropriate cell lines for transfection that reflect the tissue of interest (e.g., DF40 fibroblast cells have been used successfully)

  • Include proper controls with known expression patterns

  • Normalize luciferase activity using an internal control reporter

  • Perform multiple biological replicates to account for variation

This approach has successfully demonstrated approximately 20% elevated expression from the Ml haplotype compared to the wild-type ml+ haplotype, supporting the role of these polymorphisms in transcriptional regulation of GJA5 .

What methods are most reliable for assessing gap junction function in cells expressing recombinant chicken GJA5?

To assess gap junction function in cells expressing recombinant chicken GJA5, several complementary approaches should be employed:

  • Dye transfer assays: Using gap junction-permeable tracers like Lucifer Yellow to measure intercellular communication. This technique has successfully demonstrated functional differences between wild-type and mutant connexin proteins .

  • Immunofluorescent staining and confocal microscopy: This approach allows visualization of gap junction plaques at cell-cell interfaces. Cells expressing mutant GJA5 may form sparse or no visible gap-junction plaques in regions of cell-cell contact .

  • Electrophysiological measurements: Patch-clamp techniques can directly measure electrical coupling between adjacent cells expressing GJA5.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can quantify the rate of fluorescent molecule exchange between coupled cells.

When performing these assays, researchers should include appropriate controls and standardize experimental conditions, as gap junction function can be influenced by multiple factors including cell density, culture conditions, and expression levels.

How can zebrafish models be utilized to study GJA5 function across species?

Zebrafish models have proven valuable for studying GJA5 function through the following methodology:

This approach has demonstrated that microinjection of mutant human GJA5-p.Pro265Ser disrupts heart tube morphology in 37% of embryos, compared to only 6% in wild-type GJA5-injected embryos . The zebrafish model provides a rapid and cost-effective system to functionally evaluate GJA5 variants across species, making it particularly valuable for comparative studies between chicken and human GJA5 function.

What genomic approaches are most effective for identifying regulatory mutations affecting chicken GJA5?

For identifying regulatory mutations affecting chicken GJA5, the following genomic approaches have proven effective:

  • Whole-genome sequencing (WGS): Analysis of publicly available WGS data from different chicken breeds with distinct phenotypes can identify candidate regulatory variants .

  • Identity-by-descent (IBD) mapping: This technique can narrow down candidate regions by comparing genetic segments shared among individuals with similar phenotypes .

  • Comparative genomic analysis: Examination of conservation patterns across species can highlight functionally important regulatory regions.

  • Integration with chromatin accessibility data: Combining sequence information with data on chromatin structure can pinpoint potential regulatory elements.

The insertion/deletion polymorphism located at the 5′ end of GJA5 that causes the Melanotic phenotype was identified using a combination of these approaches, specifically through back-cross experiments between Dark Cornish and Partridge Plymouth Rock chickens, coupled with analysis of WGS data .

How can CRISPR-Cas9 technology be applied to investigate GJA5 function in chicken models?

CRISPR-Cas9 technology offers powerful approaches to investigate GJA5 function in chicken models:

  • Targeted mutation of coding regions: Design guide RNAs targeting specific exons of GJA5 to create knockout or knockin models.

  • Regulatory element editing: Target non-coding regulatory regions (such as the identified InDel1 region) to investigate their role in GJA5 expression.

  • Homology-directed repair: Introduce specific mutations corresponding to known variants (like those associated with the Melanotic phenotype) to confirm causality.

  • CRISPRa/CRISPRi approaches: Use CRISPR activation or interference techniques to modulate GJA5 expression without altering the sequence.

When applying these techniques to chicken models, researchers should consider the delivery method (in ovo electroporation, viral vectors, or direct injection into embryos) and appropriate timing based on developmental stages relevant to the phenotype of interest.

How conserved is GJA5 structure and function between chicken and mammalian models?

GJA5 shows significant conservation between avian and mammalian species, though with important differences:

  • Sequence conservation: The protein-coding regions of GJA5 are highly conserved across vertebrates, with the transmembrane domains showing particularly high conservation .

  • Functional conservation: The role of GJA5 in cardiovascular development appears conserved across species. In mice, similar to chickens, Gja5 is expressed in arteries and plays a functional role in flow-driven arteriogenesis .

  • Regulatory differences: The regulatory mechanisms controlling GJA5 expression show more variation between species, with chicken-specific regulatory elements identified near the 5′ end of the gene .

  • Disease associations: In humans, GJA5 mutations have been associated with atrial fibrillation and tetralogy of Fallot (TOF) , while in chickens, regulatory variants affect pigmentation patterns . This suggests both conservation and divergence in the physiological roles of GJA5.

Understanding these similarities and differences is crucial when translating findings between model organisms and when considering chicken GJA5 as a model for human cardiovascular conditions.

Can chicken GJA5 models inform our understanding of human GJA5-related pathologies?

Chicken models of GJA5 can provide valuable insights into human GJA5-related pathologies through several mechanisms:

  • Cardiovascular development: The role of GJA5 in arterial development and identity in chicken embryos can inform our understanding of human congenital heart defects associated with GJA5 mutations, such as tetralogy of Fallot .

  • Functional conservation: The gap junction functionality mediated by GJA5 appears mechanistically similar between species, making functional studies in chicken cells relevant to human pathology.

  • Regulatory mechanisms: Understanding the cis-regulatory elements controlling GJA5 expression in chickens may provide insights into potential regulatory mechanisms in humans that could be disrupted in disease states.

  • Experimental advantages: The accessibility of the chicken embryo for manipulation and observation provides unique opportunities for studying developmental roles of GJA5 that are challenging in mammalian models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.