Recombinant Chicken Gap junction beta-6 protein (GJB6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken Gap Junction Beta-6 Protein (GJB6)

Recombinant Chicken Gap Junction Beta-6 Protein (GJB6) is a synthetic version of the avian connexin 30 protein, a key component of gap junctions that enable direct intercellular communication. Gap junctions, formed by connexin proteins, facilitate the exchange of ions (e.g., potassium), metabolites, and signaling molecules between adjacent cells . In chickens, GJB6 is critical for maintaining cellular networks in tissues such as the inner ear, skin, and epithelial layers, mirroring its roles in mammals .

Expression and Purification

The recombinant chicken GJB6 protein is produced via cell-free expression systems, ensuring high purity and consistent yield . Key specifications include:

ParameterValue
Molecular Weight30,923 Da
Purity≥85% (SDS-PAGE)
Expression SystemCell-free (in vitro protein synthesis)
Sequence CoverageFull-length (1–263 amino acids)
StorageLyophilized powder stored at -20°C/-80°C with glycerol for stability

The protein is fused with tags (e.g., His-tag) to facilitate purification and detection .

Cellular Communication Studies

Chicken GJB6 is used to investigate gap junction dynamics in avian models. Key applications include:

  • Hearing Research: GJB6’s role in potassium ion regulation in the inner ear and its association with hearing loss phenotypes .

  • Skin and Epithelial Studies: Analysis of gap junction networks in keratinocytes and dermal layers .

Disease Modeling

Mutations in GJB6 homologs (e.g., GJB2 in humans) are linked to hearing loss (DFNB1B) and ectodermal dysplasias . Recombinant chicken GJB6 may aid in studying:

  • Connexin Interactions: Protein binding assays to identify partners (e.g., GJA1, GJB2) .

  • Pathogenic Mutations: Functional assays to test disease-associated variants.

Comparative Analysis with Other GJB6 Proteins

FeatureChicken GJB6Human GJB6Mouse GJB6
Length1–263 aa (full-length)182–261 aa (C-terminal fragment)1–261 aa (full-length)
Expression SystemCell-freeE. coliE. coli
Purity≥85%≥90%≥90%
ApplicationsAvian model studies, ion transportHuman disease research, structural studiesMammalian gap junction studies

Data sources: .

Reconstitution Protocol

  1. Centrifuge vials briefly before opening.

  2. Dissolve in sterile water (0.1–1.0 mg/mL) or glycerol buffer.

  3. Avoid repeated freeze-thawing to preserve activity .

Research Implications

The recombinant chicken GJB6 protein serves as a robust tool for studying avian-specific gap junction biology. Its full-length sequence and high purity make it ideal for structural studies (e.g., cryo-EM) and functional assays . Future work may leverage this protein to explore conserved mechanisms across species, particularly in hearing and skin disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development.
Synonyms
GJB6; Gap junction beta-6 protein; Connexin-31; Cx31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
GJB6
Target Protein Sequence
MDWGALQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQDDFICNTLQPGC KNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEKKRQFRKGDQKCEYKDIEE IRTQRFRIEGTLWWTYTCSIFFRLVFEAVFMYAFYFMYDGFRMPRLMKCSAWPCPNTVDC FVSRPTEKTVFTIFMIAVSSICILLNVAELCYLLTKFFLRRSRKAGNQKHHPNHENKEET KQNEMNELISDSCQNTVIGFTSS
Uniprot No.

Target Background

Function
Gap junctions are formed by clusters of closely packed pairs of transmembrane channels, known as connexons. These connexons facilitate the diffusion of low molecular weight materials between adjacent cells.
Gene References Into Functions
  1. Coexpression of Cx26/Cx30 is uniquely observed in gap junctions within the vertebrate inner ear. PMID: 16763027
Database Links

KEGG: gga:395771

UniGene: Gga.1951

Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Exclusively expressed in the cochlea of the inner ear, where it is found in cells of the tegmentum vasculosum, cuboidal cells, supporting cells and clear cells.

Q&A

What is the basic structure and function of chicken GJB6 protein?

GJB6 (connexin 30) belongs to the connexin protein family that forms gap junction channels. These channels permit the transport of nutrients, ions, and signaling molecules between adjoining cells. The size of the gap junction and the types of particles that move through it are determined by the particular connexin proteins comprising the channel. Gap junctions made with connexin 30 primarily transport potassium ions and certain small molecules . Structurally, connexins form hexameric structures called connexons or hemichannels that dock with compatible connexons from adjacent cells to create a complete gap junction channel. The extracellular loops of connexins adopt an antiparallel β-barrel conformation and contain crucial intramolecular disulfide linkages that are essential for proper channel formation .

How does chicken GJB6 differ from mammalian GJB6 homologs?

While chicken GJB6 shares fundamental structural similarities with mammalian homologs, species-specific variations exist in amino acid sequences that may affect channel properties and interactions. The extracellular loops of connexins, which are environmentally exposed, dictate the geometry of interacting hemichannels during gap junction formation. In particular, the first extracellular loop is an important determinant of channel charge selectivity, while both loops contribute to proper docking between hemichannels . Researchers should anticipate potential differences in protein-protein interactions, channel permeability, and regulatory mechanisms between avian and mammalian GJB6 proteins when designing comparative studies.

What are the known tissue expression patterns of GJB6 in chickens?

Based on mammalian expression patterns, GJB6/connexin 30 is expected to be found in several different tissues, including the brain, inner ear, skin (especially the palms and soles), hair follicles, and nail beds . In the inner ear specifically, GJB6 expression has been documented in Deiters' cells, Hensen's cells, Claudius cells, inner and outer pillar cells, border cells, and the epithelium of both inner and outer sulcus. GJB6 is also expressed in type I and V fibrocytes, moderately in type II fibrocytes, and in the basal cells of the stria vascularis . While these expression patterns are based on mammalian studies, similar distributions would be expected in avian systems, though species-specific variations should be anticipated and verified experimentally.

What are the optimal expression systems for producing recombinant chicken GJB6?

For recombinant chicken GJB6 expression, researchers should consider several expression systems. Mammalian cell lines (HEK293, CHO) offer proper post-translational modifications but may have lower yields. Insect cell systems (Sf9, High Five) provide a middle ground between yield and proper protein folding. When selecting an expression system, consider that gap junction proteins require proper membrane insertion and oligomerization. Include a purification tag (His, FLAG) that doesn't interfere with the protein's functional domains, particularly avoiding modifications to the extracellular loops containing critical disulfide bonds. The choice between stable and transient expression depends on experimental needs—stable lines provide consistency for long-term studies, while transient systems offer flexibility for mutational analyses.

What vectors and promoters are most effective for chicken GJB6 expression?

When expressing recombinant chicken GJB6, vector selection should be tailored to your experimental goals. For tissue-specific expression patterns, consider specialized regulatory elements similar to the GRE (gap junction regulatory elements) approach used for GJB2 in cochlear studies . The pAd/CMV/V5-DEST vector works well for high-level expression in mammalian cells, while pFastBac is suitable for insect cell systems. Regarding promoters, CMV provides strong constitutive expression in most mammalian cells, while tissue-specific promoters can better mimic natural expression patterns. For example, using inner ear-specific regulatory elements might be advantageous when studying GJB6 in auditory contexts. Avoid using the strong CAG promoter when precise control of expression levels is needed, as overexpression of membrane proteins like GJB6 can lead to cellular toxicity or improper localization.

How can I verify the proper folding and oligomerization of recombinant chicken GJB6?

Verification of proper GJB6 folding and oligomerization requires a multi-faceted approach. Begin with biochemical techniques like non-denaturing PAGE to assess the formation of hexameric connexons. Size exclusion chromatography can further confirm appropriate oligomeric states. For structural integrity assessment, circular dichroism spectroscopy helps evaluate secondary structure elements characteristic of connexins. Immunofluorescence microscopy with antibodies against extracellular loop epitopes can verify proper protein folding in cell-based systems. The gold standard for functional verification is dye transfer assays, similar to those used in lens cell studies with other connexins . Quantify the degree of dye transfer through at least three independent experiments to establish statistical significance. Additionally, electrophysiological techniques such as dual whole-cell patch clamping can directly measure gap junction conductance between cell pairs expressing recombinant GJB6.

What methods are most effective for analyzing GJB6 trafficking and membrane localization?

For analyzing GJB6 trafficking and membrane localization, implement a multi-method approach. Confocal microscopy with fluorescently tagged GJB6 provides real-time visualization of trafficking, while immunofluorescence using antibodies against GJB6 can detect endogenous or recombinant protein. When using tags, position them at the C-terminus to avoid interfering with the critical N-terminal gating domain. Subcellular fractionation followed by Western blotting quantifies GJB6 distribution across cellular compartments. To distinguish between functional membrane-inserted GJB6 and intracellular protein, use surface biotinylation assays with membrane-impermeable biotin reagents. Brefeldin A treatment can help determine whether GJB6 follows unconventional trafficking pathways similar to Cx26, which continues to form gap junctions even after Golgi disruption . FRAP (Fluorescence Recovery After Photobleaching) analysis provides quantitative data on GJB6 mobility within the membrane, useful for comparing wild-type and mutant proteins.

How can I assess functional gap junction formation with recombinant chicken GJB6?

To assess functional gap junction formation with recombinant chicken GJB6, implement a comprehensive testing strategy. Begin with dye transfer assays using gap junction-permeable fluorescent tracers like Lucifer Yellow or neurobiotin. Quantify the degree of dye transfer based on at least three independent experiments with separate protein expressions . For more precise measurements, employ dual whole-cell patch clamping to directly measure electrical coupling between cell pairs expressing GJB6. This technique allows determination of channel conductance, voltage dependence, and gating characteristics. Fluorescence recovery after photobleaching (FRAP) can evaluate gap junction permeability in living cells. To visualize gap junction plaques, use freeze-fracture electron microscopy, which provides direct evidence of connexon assembly at cell-cell interfaces. For hemichannel function assessment, ATP release assays and calcium imaging can detect opening of undocked connexons in response to stimuli such as low extracellular calcium or mechanical stress.

What techniques are available for studying the permeability properties of chicken GJB6 channels?

For studying GJB6 channel permeability, several complementary techniques provide comprehensive characterization. Dye transfer assays using fluorescent tracers of different molecular weights and charges (Lucifer Yellow, propidium iodide, DAPI) can determine size and charge selectivity of the channels. Patch-clamp electrophysiology directly measures conductance and ion selectivity by controlling the ionic composition of the recording solutions. For determining permeability to biological molecules, implement metabolic coupling assays that measure the transfer of nucleotides or second messengers between cells. Microinjection of specific molecules followed by time-lapse microscopy quantifies the rate and extent of intercellular diffusion. To analyze hemichannel permeability specifically, use dye uptake assays under conditions that promote hemichannel opening, such as low extracellular calcium. When comparing chicken GJB6 to mammalian homologs, remember that the first extracellular loop is an important determinant of channel charge selectivity, potentially creating species-specific permeability differences .

How can chicken GJB6 be used as a model to study connexin-related hearing disorders?

Chicken GJB6 represents a valuable comparative model for studying connexin-related hearing disorders. Establish transgenic chicken models expressing mutant GJB6 variants associated with human deafness to analyze phenotypic consequences in avian cochlear development. Using the RNAscope in situ hybridization technique, quantify GJB6 expression patterns in different cochlear regions and compare with mammalian expression data . Examine the interaction between GJB6 and GJB2, as mutations in GJB6 can reduce GJB2 protein levels by disrupting regulatory sequences, impacting cochlear function . Implement viral vector-mediated gene delivery systems similar to those used for GJB2 restoration in mice to develop potential therapeutic approaches for GJB6-related hearing loss . When designing cochlear studies, remember that GJB6 typically shows higher expression than GJB2 in most cochlear cell types, except in basal cells where GJB2 dominates . This differential expression pattern may inform cell-specific targeting strategies in therapeutic development.

What are the best approaches for studying interactions between chicken GJB6 and other connexins?

To study interactions between chicken GJB6 and other connexins, particularly GJB2, implement co-immunoprecipitation assays to detect physical associations between different connexin proteins. For visualizing co-localization in cellular contexts, use dual-color super-resolution microscopy with differently tagged connexins. Proximity ligation assays provide in situ evidence of protein-protein interactions with single-molecule sensitivity. Förster resonance energy transfer (FRET) between fluorescently labeled connexins can quantify the distance between interacting proteins in living cells. When designing these experiments, consider that cells may contain either GJB2 or GJB6 gene transcripts or both, potentially forming heteromeric channels with distinct properties . To assess functional consequences of these interactions, combine electrophysiological measurements with selective knockdown of individual connexins. Remember that in cochlear models, substitutions in GJB6 can affect GJB2 protein levels, presumably due to disruption of nearby GJB2 regulatory sequences , suggesting complex regulatory interactions between these genes.

How can site-directed mutagenesis of chicken GJB6 contribute to understanding channel gating mechanisms?

Site-directed mutagenesis of chicken GJB6 offers powerful insights into channel gating mechanisms. Target key domains including the N-terminal tail (critical for voltage sensing), the first extracellular loop (important for charge selectivity), and the cytoplasmic loop (involved in pH sensing and chemical gating) . Create systematic mutation series of charged residues in these regions to establish structure-function relationships. When designing mutations, consider conserved cysteine residues in the extracellular loops, as these form essential disulfide bonds—replacing them typically results in non-functional channels that fail to form gap junctions . Implement electrophysiological analysis of mutant channels using patch-clamp techniques to quantify changes in voltage dependence, conductance, and gating kinetics. For high-throughput screening of multiple mutants, develop fluorescence-based assays that correlate channel function with measurable signals. Compare the effects of equivalent mutations in chicken GJB6 to those in mammalian homologs to identify conserved gating mechanisms and species-specific differences.

How does chicken GJB6 compare evolutionarily with other vertebrate GJB6 homologs?

From an evolutionary perspective, chicken GJB6 represents an important intermediate between mammalian and non-mammalian vertebrate connexins. Conduct phylogenetic analyses using maximum likelihood methods to establish the evolutionary relationships between avian, mammalian, and other vertebrate GJB6 sequences. Identify conserved domains that have remained unchanged across species, suggesting fundamental functional importance. The extracellular loops, which contain highly conserved cysteine residues forming critical disulfide bonds, typically show the highest sequence conservation . Regions with high variability between species may indicate adaptation to species-specific functions or regulatory mechanisms. Compare the genomic organization of the GJB6 locus across species, particularly its proximity to other connexin genes like GJB2, as this arrangement has functional significance. In mammals, GJB6 is adjacent to GJB2, and disruptions in GJB6 can affect GJB2 expression due to shared regulatory elements . Determine whether this genomic arrangement is conserved in chickens and other vertebrates.

What are the key differences in GJB6 function between avian and mammalian inner ear systems?

The functional differences of GJB6 between avian and mammalian inner ear systems reflect their distinct hearing physiologies. In mammals, GJB6 expression is high in specific cochlear regions including Deiters' cells, Hensen's cells, pillar cells, and the epithelium of both the inner and outer sulcus . Avian inner ear structures, while similar, have important anatomical differences that may affect GJB6 distribution and function. Notably, birds possess regenerative capabilities in their auditory hair cells that mammals lack, suggesting potential differences in gap junction-mediated signaling during regeneration. Use RNAscope in situ hybridization to precisely map GJB6 expression patterns in chicken cochlea compared to mammalian models . Quantify relative expression levels of GJB6 versus GJB2, as this ratio differs across cell types in mammals and may have functional significance . Compare potassium recycling pathways between species, as gap junctions formed by GJB6 contribute to maintaining proper potassium ion levels in the inner ear . These comparative analyses can provide insights into the evolutionary adaptations of gap junction systems for different hearing requirements.

How can comparative studies between chicken and mammalian GJB6 inform therapeutic approaches for connexin-related disorders?

Comparative studies between chicken and mammalian GJB6 offer valuable insights for developing therapeutic approaches for connexin-related disorders. The avian system's natural hair cell regeneration capacity, potentially involving GJB6-mediated signaling, could inform regenerative therapy strategies for mammalian hearing loss. Viral vector-mediated gene delivery approaches, similar to those used for GJB2 restoration in mouse models , can be tested in chicken systems to evaluate cross-species efficacy. When designing gene therapy vectors, consider incorporating gap junction regulatory elements (GREs) that restrict expression to appropriate cell types, as this approach improved outcomes in GJB2 restoration studies . For hearing loss therapies, note that when GJB2 is partially functional and GJB6 is absent, it can lead to detrimental inner ear changes , suggesting that restoration of both connexins may be necessary for optimal outcomes. Assess the restoration of auditory function using auditory brainstem response (ABR) measurements before and after therapeutic interventions, similar to successful approaches with GJB2 restoration .

How can I troubleshoot expression issues with recombinant chicken GJB6?

When troubleshooting recombinant chicken GJB6 expression issues, consider several potential obstacles. If protein expression is low or undetectable, verify mRNA levels by qRT-PCR to determine if the problem lies with transcription or translation. For membrane proteins like GJB6, overexpression can lead to retention in the endoplasmic reticulum—try reducing expression levels by using weaker promoters or lowering incubation temperature to 30°C during protein expression. If the protein is expressed but non-functional, check for proper cellular localization using immunofluorescence or subcellular fractionation. Consider that the addition of tags, particularly HA tags, can disrupt GJB6 function—studies with GJB2 showed that HA-tagged protein led to structural abnormalities in the inner ear despite proper trafficking to the membrane . For improved solubility during purification, use mild detergents like digitonin or DDM that preserve membrane protein structure. If connexons form but don't dock properly with neighboring cells, examine the integrity of extracellular loops and their disulfide bonding, as mutations in these regions can prevent gap junction formation .

What are common pitfalls in interpreting functional data from GJB6 experiments?

When interpreting functional data from GJB6 experiments, beware of several common pitfalls. Avoid attributing observed phenotypes solely to GJB6 without considering potential effects on other connexins, particularly GJB2, as their expression is often interconnected . In dye transfer experiments, false negatives can occur if the selected dye's molecular weight exceeds the channel's permeability limit—use multiple dyes of different sizes to comprehensively assess channel function . Be cautious with tagged constructs, as C-terminal modifications may disrupt interactions with cytoskeletal or regulatory proteins, affecting localization without completely abolishing channel formation. When using heterologous expression systems, remember that the cellular context influences connexin behavior—results from HEK293 cells may not directly translate to cochlear supporting cells. For knockout or mutation studies, compensatory upregulation of other connexins may mask expected phenotypes. In cochlear studies specifically, the reduction in GJB2 expression observed in GJB6-deficient mice is more pronounced in epithelial cells than in fibrocytes of the lateral wall and spiral limbus , highlighting the importance of cell-type specific analysis.

How can I differentiate between hemichannel activity and complete gap junction function in my experiments?

Differentiating between hemichannel activity and complete gap junction function requires careful experimental design. For hemichannel-specific assays, conduct experiments in low calcium conditions (0.2 mM or less) which promotes hemichannel opening while preventing gap junction formation. Measure ATP release or uptake of membrane-impermeable dyes like propidium iodide in single cells, as these processes occur through hemichannels but not intact gap junctions. Conversely, for gap junction-specific assessment, use dye transfer assays between adjacent cells in calcium-containing media (>1.8 mM) which keeps hemichannels closed . The scrape-loading technique specifically measures gap junction communication by introducing dyes through transient mechanical disruption of the membrane and tracking their spread to neighboring cells. For electrophysiological distinction, single-cell recordings detect hemichannel currents, while dual whole-cell patch clamping directly measures electrical coupling between cell pairs through gap junctions. When analyzing data, remember that hemichannels are more sensitive to inhibitors like carbenoxolone at lower concentrations (5-10 μM) than gap junctions (50-100 μM), providing a pharmacological means of distinction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.