Recombinant Chicken Glycerol-3-phosphate acyltransferase 3 (AGPAT9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your demand.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery times, kindly consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. Should you require dry ice shipment, please communicate this need in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPAT3; AGPAT9; RCJMB04_5j9; Glycerol-3-phosphate acyltransferase 3; GPAT-3; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; Lysophosphatidic acid acyltransferase theta; LPAAT-theta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
GPAT3
Target Protein Sequence
MEELGSLAVWLGAAWLSLVFALIVLPSALGVSLGISEAYMWVLVKTLEWATIRIEKGVKK PQPQMLKIPAANGIIERDETPMEKEIAGLHRMEFRFSDIFYFCRKGFEAIVEDEVTQRFS SEELVSWNLLTRTNVNFHYVSLRLTVVWVIGVIVRYCFLLPLRFTLAAIGITSMIVGTTV VGQLPNGSLKNYLSEVVHLTCSRILVRALSGTIHYHNKENKPQKGGICVANHTSPIDAII LTNDGCYAMVGQVHGGLMGVIQRATVKACPHVWFERSEIKDRHLVTKRLREHVADKNKLP ILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPQFGDAFWNSSKYNIVSYLLRIM TSWAIVCHVWYMPPMVRKEGEDAVQFANRVRSAIARQGGLTELPWDGGLKRAKVKDSFKE EQQKNYSKMLVRNGSQGNLPAGTESD
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of glycerol-3-phosphate to 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) by incorporating an acyl moiety at the sn-1 position of the glycerol backbone. It also converts LPA into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of Glycerol-3-phosphate acyltransferase 3 in avian species?

Chicken AGPAT9/GPAT3 primarily catalyzes the first and rate-limiting step in the de novo pathway of glycerolipid synthesis. This enzyme specifically transfers an acyl group from acyl-CoA to the sn-1 position of sn-glycerol-3-phosphate (G3P), producing lysophosphatidic acid (LPA) . This reaction represents the initial committed step in triglyceride and phospholipid biosynthesis pathways in avian tissues. Unlike some other GPAT isoforms that may have dual functionality, AGPAT9/GPAT3 predominantly functions in glycerolipid synthesis rather than in specialized lipid polymer synthesis like cutin or suberin that are found in plants. The enzyme plays a crucial regulatory role in lipid metabolism, particularly in tissues with high rates of lipid synthesis such as liver and adipose tissue, which are especially important in avian species for egg formation and energy storage .

What is the subcellular localization of chicken AGPAT9?

Based on comparative analysis with mammalian orthologs, chicken AGPAT9 is expected to primarily localize to the endoplasmic reticulum membrane. Mammalian GPAT3 and GPAT4 are classified as ER-localized isoforms, distinct from the mitochondrial GPAT1 and GPAT2 . Experimental verification of chicken AGPAT9 localization can be conducted using AGPAT9-GFP fusion proteins and fluorescence microscopy, similar to methods used for other AGPAT isoforms which have shown presence in the nuclear envelope and endoplasmic reticulum . Subcellular fractionation studies followed by Western blot analysis can provide quantitative assessment of the distribution pattern. Some GPATs and AGPATs have shown dual localization patterns, as observed with AGPAT5-GFP fusion protein which localizes in mitochondria as well as ER . Therefore, chicken AGPAT9 should be investigated for potential dual localization that may indicate specialized functions in different cellular compartments relevant to avian lipid metabolism.

What are the optimal expression systems for recombinant chicken AGPAT9?

The optimal expression system for recombinant chicken AGPAT9 depends on experimental goals and required protein yields. Several effective systems can be considered:

For high-yield expression, adenoviral expression systems have proven effective for AGPAT isoforms. As demonstrated with human AGPAT3 and AGPAT5, recombinant adenovirus infection of AD293 cells provides sufficient protein expression for enzymatic characterization . This system allows for efficient protein production while maintaining appropriate post-translational modifications.

For yeast-based expression, Saccharomyces cerevisiae strains with knockout mutations in endogenous glycerol acyltransferases (such as the gat1Δ mutant strain) provide a clean background for functional studies of chicken AGPAT9 . This approach is particularly valuable for complementation studies and activity assays.

Baculovirus-infected insect cells (Sf9) represent another viable alternative that has been successfully used for human AGPAT2 expression . This system offers advantages for larger-scale protein production and often results in properly folded eukaryotic proteins.

Bacterial expression (E. coli) may be suitable for preliminary studies or when producing protein fragments for antibody generation, though full enzymatic activity may be compromised due to lack of post-translational modifications and potential improper membrane insertion.

Each system should be optimized for expression temperature, induction conditions, and harvesting time to maximize both yield and enzymatic activity of recombinant chicken AGPAT9.

How can enzymatic activity of recombinant chicken AGPAT9 be measured in vitro?

Enzymatic activity of recombinant chicken AGPAT9 can be measured using radiometric or spectrophotometric assays that quantify either substrate consumption or product formation:

The standard radiometric assay involves measuring the conversion of [³H]LPA to [³H]PA using thin-layer chromatography separation. A reaction mixture containing buffer (typically 100 mM Tris-HCl at optimized pH), 10 μmol/l LPA, 50 μmol/l acyl-CoA (typically oleoyl-CoA), [³H]oleoyl-LPA as tracer, and BSA is initiated by adding cell lysate containing recombinant chicken AGPAT9 . After incubation (10 minutes at appropriate temperature), the reaction is terminated with acidified butanol, and lipids are extracted and separated by TLC. Radioactive spots corresponding to LPA and PA are visualized, scraped, and quantified by scintillation counting .

For testing substrate specificity, various lysophospholipids (LPE, LPC, LPG, LPI, LPS) can substitute for LPA in the above assay, and different acyl-CoA species (varying in chain length and saturation) can be used as acyl donors .

Enzyme kinetics (Km and Vmax) should be determined by varying concentrations of either acyl-CoA or lysophospholipid substrates while keeping the other component at saturating levels. Data can be analyzed using Lineweaver-Burk or Eadie-Hofstee plots to calculate kinetic parameters .

Appropriate controls include parallel reactions without enzyme, with heat-inactivated enzyme, or with lysates from cells expressing an unrelated protein (such as LacZ) to account for endogenous enzymatic activities .

What are the best approaches for purifying recombinant chicken AGPAT9?

Purification of recombinant chicken AGPAT9 requires specialized approaches due to its integral membrane protein nature:

  • Affinity tag selection is critical - a C-terminal His₆ or FLAG tag generally preserves enzymatic activity better than N-terminal tags, which might interfere with membrane insertion. Dual tags (such as His₆-TEV-FLAG) provide flexibility for sequential purification steps.

  • Membrane protein extraction requires careful detergent selection. Initial screening should evaluate mild non-ionic detergents (DDM, LMNG, Triton X-100) and zwitterionic detergents (CHAPS, FC-12) for optimal extraction while preserving enzymatic activity. Detergent concentration should be optimized around 2-3× the critical micelle concentration .

  • Purification workflow typically involves:

    • Differential centrifugation to isolate membrane fractions

    • Solubilization of membranes in optimized detergent

    • Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography to remove aggregates and improve purity

    • Optional ion exchange chromatography for further purification

  • Throughout purification, enzymatic activity should be monitored using the radiometric assay described previously. The specific activity (nmol/min/mg protein) should be calculated at each step to track purification efficiency .

  • For structural studies, consider reconstitution into nanodiscs or lipid bilayers after purification to maintain the protein in a near-native environment.

The expected yield will vary by expression system, but purities of >90% should be achievable while retaining 30-50% of the initial enzymatic activity.

How can site-directed mutagenesis be used to study chicken AGPAT9 function?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in chicken AGPAT9:

  • Target residue selection should focus on:

    • Conserved motifs in acyltransferases, particularly motifs I-IV which are critical for catalytic activity

    • Residues homologous to G163 in tomato GPAT6, which when mutated to arginine (G163R) significantly impacts phosphatase activity by altering the relationship with catalytically important Lys-176

    • Putative substrate binding pocket residues that may determine acyl-CoA or lysophospholipid specificity

    • Transmembrane domains that may influence subcellular localization

  • Mutagenesis methodology typically employs PCR-based approaches using complementary primers containing the desired mutation. The QuikChange system or overlap extension PCR are commonly employed techniques for introducing specific mutations .

  • Functional analysis of mutants should examine:

    • Enzymatic activity using radiometric assays to determine effects on catalysis

    • Substrate preference alterations by testing various acyl-CoA donors and lysophospholipid acceptors

    • Subcellular localization changes using fluorescent protein fusions

    • Protein stability and expression levels through Western blotting

  • Structure-function correlations can be enhanced by generating in silico structural models of chicken AGPAT9 based on crystal structures of related enzymes or phosphatases, similar to the approach used for SlGPAT6 modeling based on M. jannaschii phospho-Ser phosphatase .

This methodical mutation approach can reveal critical residues for catalysis, substrate binding specificity, and membrane association, advancing our understanding of the molecular mechanisms underlying chicken AGPAT9 function.

How does chicken AGPAT9 contribute to lipid metabolism in avian tissues?

Chicken AGPAT9 likely plays tissue-specific roles in avian lipid metabolism that extend beyond basic triglyceride synthesis. In liver, which is the primary site of lipogenesis in birds (unlike mammals where adipose tissue dominates), chicken AGPAT9 likely regulates the flux of glycerol-3-phosphate into the glycerolipid synthesis pathway. This is particularly significant during egg-laying periods when hepatic lipid synthesis increases dramatically to support yolk formation . In adipose tissue, chicken AGPAT9 may participate in fat deposition patterns that differ significantly from mammals, potentially contributing to the distinctive subcutaneous versus visceral fat distribution in birds.

The tissue distribution pattern of chicken AGPAT9 can be determined through quantitative PCR and Western blotting, similar to approaches used for human AGPAT3, which showed ubiquitous expression with tissue-specific variations . Interaction with other lipid metabolic enzymes should be investigated through co-immunoprecipitation or proximity labeling approaches to establish whether chicken AGPAT9 participates in multi-enzyme complexes that regulate lipid flux.

Metabolic impact can be assessed through overexpression or knockdown studies in avian cell lines or primary hepatocytes, followed by lipidomic analysis to identify specific lipid species affected. This would reveal whether chicken AGPAT9 preferentially influences triglyceride synthesis, phospholipid composition, or both, similar to how mammalian GPATs influence both pathways .

What is the role of chicken AGPAT9 in fatty liver disease models?

Chicken AGPAT9 may be implicated in avian fatty liver conditions, particularly fatty liver hemorrhagic syndrome (FLHS) and fatty liver in force-fed poultry. Based on mammalian studies showing GPAT involvement in hepatic steatosis, insulin resistance, and metabolic disorders , chicken AGPAT9 likely contributes to triglyceride accumulation in avian hepatocytes under metabolic stress conditions.

To investigate this role, researchers should:

  • Compare chicken AGPAT9 expression and activity levels between healthy livers and fatty liver models using qPCR, Western blotting, and enzymatic activity assays. Upregulation would suggest involvement in triglyceride accumulation.

  • Perform gain-of-function studies by overexpressing chicken AGPAT9 in primary avian hepatocytes or hepatoma cell lines, followed by measurement of triglyceride synthesis rates and accumulation using radioisotope incorporation and lipid extraction/quantification methods.

  • Conduct loss-of-function studies using siRNA knockdown or CRISPR-Cas9 editing of chicken AGPAT9 in relevant models to determine if reduced expression prevents triglyceride accumulation under conditions that typically induce fatty liver.

  • Evaluate potential therapeutic approaches by testing whether GPAT inhibitors (such as FSG67 used in mammalian studies ) can mitigate triglyceride accumulation in avian hepatocytes.

  • Analyze potential cross-talk between chicken AGPAT9 activity and insulin signaling pathways, as mammalian studies have established connections between GPAT function and insulin resistance .

This research would not only advance understanding of avian metabolic disorders but could potentially inform comparative studies with human non-alcoholic fatty liver disease (NAFLD).

How do post-translational modifications affect chicken AGPAT9 activity?

Post-translational modifications (PTMs) of chicken AGPAT9 likely serve as important regulatory mechanisms adjusting enzymatic activity in response to metabolic demands. While specific data on chicken AGPAT9 PTMs is limited, research approaches should focus on:

  • Phosphorylation analysis: Acyltransferases are known targets of kinases including PKA, PKC, and AMPK. Researchers should identify potential phosphorylation sites using prediction algorithms and verify them using phospho-specific antibodies or mass spectrometry. Mutations of these sites to phosphomimetic (Ser/Thr to Asp/Glu) or phospho-deficient (Ser/Thr to Ala) residues can determine functional consequences on enzymatic activity, subcellular localization, and protein-protein interactions.

  • Ubiquitination and SUMOylation: These modifications may regulate chicken AGPAT9 stability and degradation. Immunoprecipitation under denaturing conditions followed by ubiquitin or SUMO blotting can identify these modifications. Proteasome inhibitors can help determine if the protein undergoes regulated degradation.

  • Glycosylation: As an ER-associated protein, chicken AGPAT9 may undergo N-linked glycosylation. Treatment with endoglycosidases (PNGase F, Endo H) followed by mobility shift analysis can detect glycosylation. Mutation of putative glycosylation sites can reveal their importance for protein folding, stability, or activity.

  • S-acylation/palmitoylation: This modification often regulates membrane association of proteins. Acyl-biotin exchange assays or metabolic labeling with alkyne-palmitate analogs can detect palmitoylation of chicken AGPAT9.

  • Metabolic regulation: Changes in PTM patterns under different nutritional states (fasting, feeding, high-fat diet) should be investigated to understand how chicken AGPAT9 activity is modulated in response to metabolic needs.

This comprehensive analysis of PTMs would provide insights into the dynamic regulation of chicken AGPAT9 activity in different metabolic contexts.

What are the comparative enzymatic kinetics between avian and mammalian AGPAT9?

Comparative enzymatic kinetics between avian and mammalian AGPAT9 can reveal evolutionary adaptations in lipid metabolism across vertebrate classes. A comprehensive kinetic analysis should include:

  • Substrate affinity comparison: Determination of Km values for both glycerol-3-phosphate and various acyl-CoA donors should be performed under identical assay conditions. Based on data from related enzymes, mammalian AGPAT/GPAT enzymes typically show Km values for acyl-CoA ranging from 0.4-21.5 μM and for LPA from 2-9.2 μM . Chicken AGPAT9 may show distinct kinetic parameters reflecting avian-specific metabolic requirements.

  • Catalytic efficiency analysis: Calculation of Vmax/Km ratios provides insight into the catalytic efficiency for different substrates. For mammalian enzymes, these values range significantly from 0.04 to 525 for acyl-CoA and from 0.44 to 100 for LPA across different AGPAT isoforms . This comparative analysis should test whether chicken AGPAT9 shows enhanced efficiency for specific substrate combinations that might correlate with avian lipid composition requirements.

  • Temperature and pH optima: As endothermic animals with different body temperatures (chickens: ~41°C, mammals: ~37°C), the temperature optima for enzymatic activity may differ. Similarly, pH optima should be compared, as related enzymes show optimal activity at different pH values (pH 7.4 for AGPAT3 versus pH 6.5 for AGPAT5) .

  • Substrate specificity profiles: Comprehensive testing with various acyl-CoA species (varying in chain length and saturation) and different lysophospholipid acceptors can reveal species-specific preferences. For instance, some AGPATs show distinctive preferences for LPE with oleoyl-CoA (C18:1) versus LPI with arachidonoyl-CoA (C20:4) .

  • Inhibitor sensitivity profiles: Comparative responses to known GPAT inhibitors (such as FSG67 ) might reveal structural differences in the active sites between avian and mammalian enzymes.

This detailed kinetic comparison would provide valuable insights into the evolutionary adaptations of lipid metabolizing enzymes across vertebrate lineages.

Why might recombinant chicken AGPAT9 show low activity in vitro?

Recombinant chicken AGPAT9 may exhibit low enzymatic activity in vitro due to several factors that can be systematically addressed:

  • Expression system incompatibilities: The expression host may lack essential co-factors or post-translational modification machinery. Compare activity across different expression systems (bacterial, yeast, insect, and mammalian cells) to identify optimal conditions. For membrane proteins like AGPAT9, eukaryotic systems typically provide better functional expression than bacterial systems .

  • Improper membrane integration: As an integral membrane protein, chicken AGPAT9 requires proper insertion into membranes. Analyzing the protein's distribution between soluble and membrane fractions can identify potential mislocalization. If necessary, optimize membrane isolation protocols or consider using detergent micelles that better mimic native membrane environments.

  • Suboptimal assay conditions: Enzymatic activity is highly dependent on pH, temperature, and ionic strength. Systematic optimization should test ranges of conditions: pH (6.0-8.0), temperature (25-42°C), and various divalent cations (particularly Mg²⁺) at different concentrations. AGPAT isoforms show variable optimal conditions, with AGPAT3 showing optimal activity at pH 7.4 and 37°C, while AGPAT5 prefers pH 6.5 and 30°C .

  • Substrate preferences: The chicken enzyme may have different substrate specificities than expected based on mammalian orthologs. Screen a wider range of acyl-CoA donors (varying in chain length and saturation) and lysophospholipid acceptors, as different AGPAT isoforms show distinct preferences .

  • Presence of inhibitors: Endogenous inhibitors or detergents used during purification may impair activity. Dialysis or further purification steps can help remove potential inhibitors.

  • Protein stability issues: The recombinant protein may be unstable or improperly folded. Adding stabilizing agents (glycerol, specific lipids) or optimizing storage conditions (temperature, buffer composition) can improve stability and activity.

  • Detection method sensitivity: The assay may not be sensitive enough to detect low activity levels. Consider using more sensitive detection methods such as fluorescently-labeled substrates or coupling the reaction to secondary enzymes that amplify the signal.

How can substrate specificity issues be addressed in chicken AGPAT9 assays?

Addressing substrate specificity challenges in chicken AGPAT9 assays requires systematic methodology and careful experimental design:

  • Comprehensive substrate screening: Test a diverse panel of acyl-CoA donors varying in chain length (C8-C22) and saturation (saturated, monounsaturated, polyunsaturated). Similarly, screen various lysophospholipids (LPA, LPC, LPE, LPI, LPS, LPG) to identify preferred substrates . This approach revealed that while AGPAT3 prefers LPA, it also shows significant activity toward LPI when using C20:4 fatty acid, while AGPAT5 has notable activity with LPE when using C18:1 fatty acid .

  • Position-specific activity assessment: Determine whether chicken AGPAT9 exhibits regiospecificity (preference for acylation at sn-1 versus sn-2 position). Some plant GPATs demonstrate sn-2 specific acyltransferase activity, producing 2-monoacylglycerols rather than typical 1-acylglycerols . Use position-specific analysis methods such as phospholipase A1/A2 digestion followed by GC-MS analysis of released fatty acids.

  • Competitive substrate assays: When multiple substrates show activity, perform competition experiments by including both substrates simultaneously at varying ratios. This approach can reveal substrate preferences that might not be apparent when testing substrates individually.

  • Kinetic parameter determination: Calculate Km and Vmax values for each substrate to establish quantitative preference profiles. The Vmax/Km ratio provides a measure of catalytic efficiency and substrate preference . For mammalian AGPAT isoforms, Vmax/Km values range from 0.04-525 for acyl-CoA and 0.44-100 for LPA .

  • Acyl-CoA availability considerations: Ensure that acyl-CoA substrates maintain their integrity during assays, as they can undergo hydrolysis. Include acyl-CoA binding protein (ACBP) or additional BSA in reaction mixtures to stabilize acyl-CoA.

  • Validation with endogenous substrates: Compare in vitro preferences with lipid compositions found in chicken tissues to determine physiological relevance of substrate preferences.

  • Structure-guided mutagenesis: Based on structural models of chicken AGPAT9, identify and mutate residues in putative substrate binding pockets to alter specificity, similar to approaches used with other GPATs .

This systematic approach will provide a comprehensive substrate specificity profile for chicken AGPAT9 and enable comparison with mammalian orthologs.

What are solutions for protein instability when working with recombinant chicken AGPAT9?

Membrane proteins like chicken AGPAT9 present significant stability challenges that can be addressed through multiple approaches:

  • Buffer optimization: Systematic screening of buffer conditions can identify stabilizing formulations. Key variables include:

    • pH range (6.0-8.0)

    • Salt type and concentration (150-500 mM NaCl or KCl)

    • Buffer systems (HEPES, Tris, phosphate)

    • Glycerol content (10-30%)

    • Reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

  • Detergent selection: For extraction and purification, test multiple detergent classes:

    • Non-ionic detergents (DDM, LMNG, Triton X-100)

    • Zwitterionic detergents (CHAPS, FC-12)

    • Mixed micelles (detergent/lipid combinations)

    Using multiple orthogonal methods (activity assays, thermal shift assays, and SEC-MALS) can help identify optimal detergent conditions .

  • Lipid supplementation: Including specific phospholipids that mimic the native membrane environment can significantly enhance stability:

    • Phosphatidylcholine (PC)

    • Phosphatidylethanolamine (PE)

    • Cholesterol

    • Native lipid extracts from chicken tissues

  • Protein engineering approaches:

    • Truncation of flexible termini if they don't affect activity

    • Introduction of disulfide bridges to stabilize tertiary structure

    • Fusion with stability-enhancing proteins (GFP, MBP) that can be later removed by protease cleavage

  • Expression optimization:

    • Lower expression temperatures (16-25°C) often improve folding

    • Co-expression with chaperones

    • Use of specialized expression strains

  • Storage conditions:

    • Flash-freezing in liquid nitrogen with cryoprotectants

    • Storage at higher protein concentrations (>1 mg/ml)

    • Addition of substrate or substrate analogs to stabilize active conformation

  • Alternative solubilization strategies:

    • Nanodiscs or SMALPs (styrene-maleic acid lipid particles) that maintain a lipid bilayer environment

    • Amphipols that can replace detergents after extraction

  • Thermal stability assessment:

    • Use differential scanning fluorimetry to identify conditions that maximize thermal stability

    • Conditions that increase melting temperature (Tm) by 5-10°C often correlate with enhanced long-term stability

By systematically applying these approaches, researchers can identify conditions that maximize stability while maintaining enzymatic activity of recombinant chicken AGPAT9.

How can conflicting results in chicken AGPAT9 studies be reconciled?

Reconciling conflicting results in chicken AGPAT9 research requires systematic investigation of methodological differences and biological variables:

  • Expression system variations: Different expression systems may yield proteins with varying post-translational modifications and activity levels. Direct comparison studies using identical protein preparations in multiple assay systems can identify whether discrepancies stem from the expression system used. Previous studies with AGPAT3 found different enzymatic activities depending on whether a plasmid-based or viral expression system was used .

  • Assay condition standardization: Enzymatic assays for acyltransferases are highly sensitive to reaction conditions. Systematic comparison should evaluate:

    • Buffer composition and pH

    • Temperature and incubation time

    • Substrate concentrations and presentations (micelles, vesicles)

    • Detergent type and concentration if used

    • Divalent cation concentrations

    For example, AGPAT3 and AGPAT5 show optimal activity at different pH values (7.4 vs. 6.5) and temperatures (37°C vs. 30°C) .

  • Substrate quality assessment: Acyl-CoA substrates can degrade during storage or assay conditions. Implementing quality control measures for substrates (HPLC analysis before use) and including acyl-CoA binding proteins in assays can minimize this variable.

  • Genetic background considerations: For studies using primary chicken cells or tissues, genetic variation between chicken breeds or strains may contribute to functional differences in AGPAT9. Documenting the genetic background and considering breed-specific differences is important.

  • Meta-analysis approach: When literature reports conflicting findings, conduct a meta-analysis that quantitatively combines results across studies while accounting for methodological differences. This can reveal whether discrepancies follow patterns related to specific methodological choices.

  • Reproducibility initiatives: Establish collaborative projects where multiple laboratories perform identical experiments following standardized protocols to determine which findings are consistently reproducible.

  • Tissue-specific or developmental regulation: Conflicting results may reflect genuine biological differences if studies used samples from different tissues or developmental stages. AGPAT isoforms show tissue-specific expression patterns that may influence activity and function .

  • Terminology and classification issues: Ensure that the same enzyme is being studied across reports, as nomenclature for the GPAT/AGPAT family has evolved, with some enzymes being reclassified or having multiple designations (e.g., AGPAT10/GPAT3/AGPAT8) .

By systematically evaluating these factors, researchers can identify sources of discrepancies and develop a unified understanding of chicken AGPAT9 function.

What are emerging techniques for studying chicken AGPAT9 in vivo?

Emerging technologies offer powerful new approaches for investigating chicken AGPAT9 function in vivo:

  • CRISPR-Cas9 genome editing in chicken embryos and cell lines provides unprecedented opportunities for creating knockout or knock-in models. This technology can generate:

    • Complete AGPAT9 knockout chickens to assess physiological impacts

    • Endogenous tagging with fluorescent proteins for real-time visualization

    • Introduction of specific mutations identified in enzymatic studies

    • Reporter gene knock-ins to monitor endogenous expression patterns

  • Single-cell transcriptomics and proteomics can reveal cell-type specific expression patterns of chicken AGPAT9 across tissues. This approach identifies specific cell populations where AGPAT9 is particularly active, providing insights into its tissue-specific functions that might be masked in whole-tissue analyses.

  • Live-cell metabolic imaging using fluorescent lipid analogs combined with fluorescently-tagged AGPAT9 enables real-time visualization of enzyme activity and lipid metabolism in living cells. Techniques such as FRET-based biosensors can detect changes in lipid products in response to metabolic stimuli.

  • Proximity labeling approaches (BioID, APEX) allow identification of the AGPAT9 interactome in situ. By expressing chicken AGPAT9 fused to a proximity labeling enzyme, researchers can identify proteins that interact with AGPAT9 in its native cellular environment, providing insights into its regulation and functional integration within metabolic networks.

  • Organoid models derived from chicken tissues can provide more physiologically relevant systems than conventional cell cultures for studying AGPAT9 function. These three-dimensional cultures better recapitulate tissue architecture and cell-cell interactions that may influence lipid metabolism.

  • In ovo electroporation techniques permit spatial and temporal control of chicken AGPAT9 expression during embryonic development, allowing investigation of its developmental roles in lipid metabolism.

  • Stable isotope tracing combined with mass spectrometry imaging can visualize metabolic flux through pathways involving AGPAT9 with spatial resolution in tissues, providing insights into regional differences in activity.

These emerging technologies promise to transform our understanding of chicken AGPAT9 function in complex physiological contexts beyond what has been possible with traditional biochemical approaches.

How might chicken AGPAT9 research inform comparative lipid metabolism studies?

Chicken AGPAT9 research offers valuable perspectives for comparative lipid metabolism studies across vertebrate lineages:

  • Evolutionary adaptation insights: Birds have unique metabolic demands for egg production, flight, and thermoregulation. Comparing chicken AGPAT9 with mammalian, reptilian, and amphibian orthologs can reveal how lipid synthetic pathways have adapted to these diverse physiological challenges. Kinetic parameters (Km, Vmax, substrate preferences) often reflect evolutionary adaptations to specific metabolic needs .

  • Tissue-specific metabolic specializations: Birds show distinctive lipid distribution patterns compared to mammals, particularly regarding adipose tissue distribution and hepatic lipid metabolism. Studying chicken AGPAT9 tissue expression patterns and tissue-specific activities can illuminate how different vertebrate lineages have evolved specialized lipid metabolic pathways in different organs.

  • Fasting/feeding adaptation mechanisms: Birds and mammals have evolved different strategies for managing energy metabolism during fasting periods. Examining how chicken AGPAT9 activity and regulation responds to feeding/fasting cycles compared to mammalian orthologs may reveal convergent or divergent metabolic adaptations.

  • Disease model development: Avian models of metabolic disorders can complement mammalian models, potentially revealing conserved and divergent pathogenic mechanisms. For example, studies linking chicken AGPAT9 to fatty liver development could inform understanding of both species-specific and conserved mechanisms of hepatic steatosis development .

  • Reproductive metabolism insights: The extraordinary demands of egg production in birds involve massive lipid mobilization and transport systems that differ from mammalian pregnancy. Studying chicken AGPAT9's role in this process may reveal specialized adaptations for reproductive lipid metabolism.

  • Environmental adaptation mechanisms: Comparing AGPAT9 from chickens adapted to different environments (tropical versus temperate) could reveal how lipid metabolism enzymes evolve in response to different thermal challenges.

  • Nutritional ecology applications: Understanding how chicken AGPAT9 processes different dietary fatty acids can inform optimal nutrition strategies across species and reveal how lipid metabolism adapts to diverse diets across vertebrate lineages.

Such comparative studies can ultimately illuminate fundamental principles of metabolic pathway evolution while also providing practical insights for both human medicine and animal agriculture.

What are potential applications of chicken AGPAT9 in metabolic engineering?

Chicken AGPAT9 offers several promising applications in metabolic engineering approaches:

  • Designer lipid production: The substrate preferences of chicken AGPAT9 could be exploited to produce specialized lipids with defined fatty acid compositions. By expressing chicken AGPAT9 in production organisms (yeast or bacteria) and controlling substrate availability, researchers could generate phospholipids or triglycerides with specific fatty acid distributions at the sn-1 and sn-2 positions. This approach could yield lipids optimized for nutritional, pharmaceutical, or industrial applications.

  • Metabolic pathway optimization: Chicken AGPAT9 could be incorporated into synthetic biology approaches aiming to redirect carbon flux toward lipid production. Co-expression with other enzymes in the glycerolipid synthesis pathway might be used to establish complete synthetic pathways for producing complex lipids in heterologous systems. The kinetic parameters of chicken AGPAT9 (Km, Vmax) would inform modeling efforts to predict and optimize flux through these engineered pathways .

  • Comparative enzymatic properties exploitation: If chicken AGPAT9 exhibits unique catalytic properties compared to mammalian orthologs—such as altered substrate specificity, temperature optima, or regulatory mechanisms—these features could be valuable in biotechnological applications requiring specific reaction conditions or substrates.

  • Structure-guided enzyme engineering: As understanding of chicken AGPAT9 structure-function relationships advances, rational engineering of the enzyme could enhance desired properties such as thermal stability, catalytic efficiency, or altered substrate specificity. Site-directed mutagenesis targeting residues identified as important for catalysis or substrate binding could generate variants with novel activities .

  • Biopharmaceutical applications: Given the role of specific phospholipids in drug delivery systems and liposomal formulations, engineered chicken AGPAT9 variants could be employed to produce phospholipids with defined compositions for pharmaceutical applications. The ability of some AGPAT isoforms to utilize various lysophospholipids suggests potential for producing diverse phospholipid species .

  • Agricultural applications: Metabolic engineering approaches using chicken AGPAT9 could potentially improve nutritional quality of poultry products or enhance resistance to metabolic disorders in production animals through targeted modification of lipid metabolism pathways.

These applications represent the intersection of fundamental enzymology research with applied biotechnology, highlighting the practical significance of detailed mechanistic studies of chicken AGPAT9.

How might structural studies of chicken AGPAT9 advance our understanding of acyltransferase mechanisms?

Structural studies of chicken AGPAT9 would provide transformative insights into acyltransferase mechanism and evolution:

  • Catalytic mechanism elucidation: A high-resolution structure of chicken AGPAT9 would reveal the precise arrangement of catalytic residues and their roles in the acyltransferase reaction. This would address longstanding questions about how these enzymes achieve acyl transfer, including:

    • How acyl-CoA and lysophospholipid substrates are positioned in the active site

    • The roles of conserved motifs in substrate binding and catalysis

    • The molecular basis for regiospecificity (sn-1 versus sn-2 acylation)

    • Conformational changes during catalysis

  • Substrate specificity determinants: Structural data, especially co-crystal structures with different substrates or substrate analogs, would identify the structural features that determine substrate preferences. This could explain why some AGPAT isoforms show preferences for specific lysophospholipids when paired with particular acyl-CoA species, such as AGPAT3's preference for LPI with arachidonoyl-CoA or AGPAT5's preference for LPE with oleoyl-CoA .

  • Evolutionary insights: Comparing chicken AGPAT9 structure with other acyltransferases across species would reveal conserved structural elements that have been maintained throughout evolution versus regions that have diverged to enable specialized functions. This evolutionary perspective would be particularly valuable for understanding how different GPAT/AGPAT isoforms evolved specialized roles in membrane versus storage lipid synthesis.

  • Membrane interaction mechanisms: As an integral membrane protein, structural studies would illuminate how chicken AGPAT9 interacts with the membrane bilayer and accesses lipid substrates. This might include identification of structural features that facilitate extraction of lysophospholipids from the membrane and re-insertion of products.

  • Structure-guided inhibitor design: A detailed structure would enable rational design of specific inhibitors of chicken AGPAT9, which could serve as research tools and potential therapeutic leads for metabolic disorders. Previous studies have demonstrated the utility of GPAT inhibitors like FSG67 in metabolic disease models .

  • Comparative structural biology: Structural comparison between chicken AGPAT9 and GPATs from diverse organisms—from bacteria to plants to mammals—would provide insights into the evolution of this ancient enzyme family. This could reveal how structural adaptations correlate with functional specialization across phylogeny, particularly relevant given the expanded and diversified GPAT families in land plants that have evolved specialized functions beyond membrane lipid synthesis .

These structural insights would not only advance our fundamental understanding of acyltransferase mechanisms but also enable numerous biotechnological and biomedical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.