Recombinant Chicken Hyaluronan synthase 2 (HAS2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Chicken HAS2 is typically expressed in E. coli systems for research applications. A widely used product (CSB-EP010140CH1) includes the following specifications :

ParameterDetails
Expression SystemE. coli
Purity>85% (SDS-PAGE verified)
StorageLyophilized form stable for 12 months at -20°C/-80°C
Reconstitution0.1–1.0 mg/mL in sterile water with 50% glycerol for long-term stability
TagDetermined during manufacturing (commonly His-tag or GFP fusion)

Enzymatic Efficiency

  • Substrate affinity: HAS2 exhibits K<sub>m</sub> values of 0.12 mM for UDP-GlcA and 0.08 mM for UDP-GlcNAc, outperforming HAS1 and HAS3 in catalytic efficiency .

  • HA output: Transfection of HAS2 in HEK cells increases HA secretion by 6.5–9× compared to controls .

Biological Roles

  • Embryogenesis: Critical for cardiac cushion formation and mesenchymal cell migration during heart development .

  • Tissue repair: Mediates HA accumulation in choroidal thickening during ocular growth regulation .

Applications in Research

Recombinant Chicken HAS2 is utilized in:

  • HA production studies: Quantifying HA synthesis kinetics using ELISA or size-exclusion chromatography .

  • Disease modeling: Investigating HA-deficient pathologies (e.g., cardiac septal defects) .

  • Therapeutic development: Testing gene therapy approaches for joint disorders .

Detection and Quantification Tools

The Chicken HAS2 ELISA Kit (CHEB0221) enables sensitive detection in biological samples :

Kit ComponentDetails
Detection Range0.312–20 ng/mL
Sample TypesSerum, plasma, cell culture supernatants
Intra-/Inter-assay CV<10% (provided with kit-specific validation)
SpecificityNo cross-reactivity with HAS1 or HAS3

Challenges and Future Directions

  • Structural limitations: The C-terminal domain’s role in catalysis remains undefined, necessitating further mutagenesis studies .

  • Technical optimization: Improving recombinant protein stability during lyophilization and reconstitution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HAS2; Hyaluronan synthase 2; Hyaluronate synthase 2; Hyaluronic acid synthase 2; CHAS2; HA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
HAS2
Target Protein Sequence
MYCERFICILRILGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAILASHLIIQ SLFAYLEHRKMKRSLETPIKLNKTVALCIAAYQEDPDYLRKCLLSVKRLTYPGIKVVMVI DGNSEDDVYMMDIFTEIMGRDKSATYIWSNNFHDKGPGETEESHRESMQHVSQLVLSNKS VCIMQKWGGKREVMYTAFKALGEAWNYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY NQEFMGSQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR EWLYNAMWFHKHHLWMTYEAVITGFFPFFLIATVIQLFYRGKIWNILLFLLTVQLVGLIK SSFASFLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP VSIWFTILLGRVIFTIYKESKKPFSESKTTVLVIGTILYACYWVLLLTLYLVLITKCGRR KKEQHYDMVLDV
Uniprot No.

Target Background

Function

Recombinant Chicken Hyaluronan synthase 2 (HAS2) catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. This essential enzyme is crucial for hyaluronan synthesis, a major component of most extracellular matrices. Hyaluronan plays a vital structural role in tissue architecture and regulates cell adhesion, migration, and differentiation.

Database Links

STRING: 9031.ENSGALP00000026394

UniGene: Gga.329

Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Chicken Hyaluronan Synthase 2 and what are its primary functions?

Chicken Hyaluronan Synthase 2 (HAS2) is a key enzyme involved in the synthesis of hyaluronan, a critical component of the extracellular matrix. HAS2 catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer . This enzyme plays a crucial role in tissue hydration and lubrication through its production of hyaluronic acid. HAS2 is characterized as a multi-pass membrane protein with the UniProt identification code O57424 . Its primary function involves maintaining the structural integrity of tissues through hyaluronan production, which supports cellular processes including migration, proliferation, and differentiation.

How does Chicken HAS2 differ structurally and functionally from mammalian HAS2 variants?

While the search results don't provide direct comparison between chicken and mammalian HAS2 variants, research indicates that HAS2 is highly conserved across species with similar functional roles. The chicken HAS2 (CHAS2) maintains the core enzymatic function of catalyzing hyaluronan synthesis . Like its mammalian counterparts, chicken HAS2 is membrane-bound and involved in extracellular matrix maintenance. The research on human vascular smooth muscle cells demonstrates that HAS2 regulates cell shape and spreading , suggesting similar functional conservation across species. Notable differences may exist in regulatory pathways and expression patterns that are species-specific, but the fundamental enzymatic mechanism of adding monosaccharides to hyaluronan polymers remains conserved.

What are the optimal storage conditions for recombinant Chicken HAS2 protein to maintain activity?

For optimal storage of recombinant Chicken HAS2 protein, the following conditions are recommended:

  • Lyophilized form can be stored at -20°C/-80°C with a shelf life of approximately 12 months

  • Liquid form typically maintains stability for 6 months at -20°C/-80°C

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freezing and thawing should be avoided to maintain protein integrity

For reconstitution, it is recommended to:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (with 50% being the standard recommendation) as a cryoprotectant

  • Aliquot for long-term storage at -20°C/-80°C

These conditions help preserve the enzymatic activity and structural integrity of the recombinant protein for research applications.

What techniques are most effective for analyzing HAS2 expression in experimental samples?

Based on established research protocols, the following methods have proven effective for analyzing HAS2 expression:

  • Semiquantitative RT-PCR: This technique allows for relative quantification of HAS2 mRNA levels. Using 250 ng of total mRNA per reaction is recommended, with GAPDH as a reference gene for normalization . The specific primers for chicken HAS2 should be designed based on the target sequence.

  • ELISA-based detection: For protein-level quantification, ELISA kits specifically designed for Chicken HAS2 provide high sensitivity and specificity in various sample types including serum, plasma, and cell culture supernatants .

  • Western blotting: This technique can be employed to verify protein expression and analyze post-translational modifications.

  • siRNA-mediated knockdown: To validate HAS2 function, siRNA targeting HAS2 can be designed and transfected into cells to reduce expression. This approach can be combined with functional assays to assess the impact of reduced HAS2 levels .

For optimal results, it is recommended to perform both mRNA and protein-level analyses to comprehensively evaluate HAS2 expression in experimental samples.

How is HAS2 expression regulated at the transcriptional level in avian systems?

While the search results do not specifically address transcriptional regulation in avian systems, insights from related research in human cells provide valuable information that may be applicable.

In human vascular smooth muscle cells, HAS2 expression is regulated through several pathways:

  • Prostaglandin signaling: Prostaglandin I2 (via IP receptors) and Prostaglandin E2 (via EP2 receptors) induce HAS2 mRNA expression .

  • cAMP/PKA pathway: HAS2 mRNA expression is elevated by db-cAMP and forskolin, and can be inhibited by H89 (a PKA inhibitor), indicating regulation through the cAMP/PKA-dependent signaling pathway .

  • COX2-dependent regulation: Inhibition of COX2 with specific inhibitors such as etoricoxib leads to almost undetectable levels of HAS2 mRNA, suggesting that basal HAS2 expression depends on endogenous COX2 activity .

These regulatory mechanisms observed in human cells provide a foundation for investigating similar pathways in avian systems, though species-specific differences may exist and would require direct experimental verification in chicken cells.

What signaling molecules and growth factors modulate HAS2 activity in developmental processes?

Research demonstrates that several signaling molecules and growth factors influence HAS2 activity in developmental processes:

  • Prostaglandins: In human vascular smooth muscle cells, prostacyclin (PGI2) and prostaglandin E2 (PGE2) strongly induce HAS2 expression through cAMP/PKA-dependent pathways .

  • Growth factors: Studies suggest that growth factors like PDGF-BB (Platelet-Derived Growth Factor-BB) can induce HA-rich matrix formation in smooth muscle cells . Evidence from other cell types indicates that EGF (Epidermal Growth Factor) in keratinocytes and PDGF-BB in mesothelial cells specifically induce HAS2 mRNA .

  • Cytokines: Interleukin-1 has been shown to induce HAS2 in orbital fibroblasts, suggesting inflammatory mediators play a role in regulating HAS2 expression .

  • Developmental regulators: During limb development, Has2 expression and HA production are downregulated in specific regions during the formation of precartilage condensations, indicating temporal and spatial regulation of HAS2 activity is crucial for proper skeletal development .

The precise interaction between these factors may vary between species and developmental contexts, but they collectively demonstrate the complex regulation of HAS2 in tissue development and homeostasis.

What phenotypic effects result from HAS2 knockdown in avian cell culture systems?

The search results provide information about HAS2 knockdown effects in human cells that may inform similar studies in avian systems. In human arterial smooth muscle cells, siRNA targeting HAS2 resulted in several significant phenotypic changes:

  • Reduced HA secretion: HAS2 siRNA caused approximately 50% reduction in hyaluronic acid secretion .

  • Altered cell morphology: Suppression of HAS2 expression dramatically increased the substratum areas occupied by individual cells .

  • Enhanced cell spreading: Cells transfected with HAS2-siRNA exhibited much thinner cytoplasm in close contact with the surface underneath .

  • Potential changes in migration and proliferation: Based on similar studies in keratinocytes, reduced HAS2 expression increased focal adhesion plaques and reduced migration and proliferation .

These findings suggest that in avian cell systems, HAS2 knockdown would likely affect cell morphology, adhesion properties, and potentially proliferation and migration capabilities. The establishment of close contacts with the substratum in the absence of endogenous HAS2 expression suggests a shift toward a less migratory and less proliferative phenotype.

What is the impact of HAS2 overexpression on tissue development and matrix organization?

Overexpression of HAS2 has profound effects on tissue development and matrix organization:

  • Skeletal development: In vivo overexpression of Has2 in the mesoderm of chick limb buds results in shortened and severely malformed limbs .

  • Skeletal element formation: HAS2 overexpression can lead to the absence of one or more skeletal elements and/or skeletal elements with abnormal morphology positioned inappropriately .

  • Cartilage differentiation: Sustained production of HA in vivo perturbs limb growth, patterning, and cartilage differentiation .

  • Precartilage condensation: In micromass cultures of limb mesenchymal cells, sustained HA production inhibits the formation of precartilage condensations and subsequent chondrogenesis .

These findings demonstrate that precise regulation of HAS2 expression and activity is critical for normal tissue development, particularly in skeletal formation. Excessive HA production disrupts the cellular interactions necessary for proper condensation and differentiation of precartilage tissues, highlighting the importance of temporal and spatial regulation of HAS2 in developmental processes.

How can recombinant Chicken HAS2 be utilized in tissue engineering applications?

Recombinant Chicken HAS2 presents several potential applications in tissue engineering:

  • Generation of customized hyaluronic acid matrices: Recombinant HAS2 can be employed to synthesize hyaluronic acid polymers of defined length and composition for tissue engineering scaffolds. The enzyme's ability to catalyze the addition of specific monosaccharides allows for precise control over the resulting HA structure .

  • Cartilage and joint tissue engineering: Given HAS2's crucial role in skeletal growth, patterning, and synovial joint formation , the recombinant enzyme could be utilized to develop improved methods for cartilage regeneration and joint tissue engineering.

  • Vascular tissue engineering: Research demonstrating HAS2's involvement in vascular smooth muscle cell phenotype regulation suggests applications in vascular graft development and blood vessel engineering.

  • Controlled delivery systems: By incorporating recombinant HAS2 into biomaterial systems, it may be possible to create materials with dynamic, cell-responsive properties where hyaluronic acid synthesis occurs in response to specific cellular signals.

  • In vitro disease models: Recombinant HAS2 could be used to establish in vitro models of diseases associated with dysregulated hyaluronic acid production, such as certain inflammatory conditions and cancers .

Implementation would require careful consideration of enzyme stability, activity control, and integration with other matrix components to achieve the desired tissue properties.

What experimental strategies can be employed to investigate HAS2 interactions with other extracellular matrix components?

Several advanced experimental strategies can be utilized to investigate HAS2 interactions with other extracellular matrix components:

  • Co-immunoprecipitation studies: Using antibodies against HAS2 to pull down protein complexes, followed by mass spectrometry analysis to identify interacting partners within the extracellular matrix.

  • Proximity labeling techniques: Methods such as BioID or APEX2 can be employed by fusing these enzymes to HAS2, allowing for biotinylation of proteins in close proximity to HAS2 in living cells.

  • FRET/BRET analysis: Fluorescence or bioluminescence resonance energy transfer can detect direct interactions between HAS2 and other matrix proteins when tagged with appropriate fluorophores or luciferase.

  • siRNA-mediated knockdown combined with ECM analysis: As demonstrated in the research, siRNA targeting HAS2 affects cell morphology and behavior . This approach can be extended to analyze changes in composition and organization of other ECM components following HAS2 knockdown.

  • In vitro binding assays: Using purified recombinant Chicken HAS2 in combination with other purified ECM components to assess direct binding interactions through techniques such as surface plasmon resonance or isothermal titration calorimetry.

  • 3D culture systems: Establishing 3D culture environments where HAS2-producing cells interact with various ECM components, followed by confocal microscopy and spatial analysis of matrix organization.

These methods can provide comprehensive insights into how HAS2 and its product, hyaluronic acid, interact with and influence the broader extracellular matrix environment in both normal and pathological conditions.

What are the relative advantages of ELISA versus PCR-based methods for HAS2 detection in research samples?

ParameterELISA-based DetectionPCR-based Detection
Target moleculeHAS2 protein HAS2 mRNA
SensitivityHigh sensitivity for protein detection in serum, plasma, and cell culture supernatants Can detect low abundance transcripts with appropriate cycle optimization
SpecificityHigh specificity for natural and recombinant chicken Hyaluronan synthase 2 Depends on primer design; can be highly specific with properly designed primers
Sample typesEffective for serum, plasma, tissue homogenates, cell culture supernatants Requires RNA extraction; works with tissues, cells, and some biological fluids
QuantificationAbsolute quantification possible with standard curvesRelative quantification using reference genes like GAPDH ; absolute quantification possible with standard curves
Post-translational modificationsCan detect the protein regardless of modificationsCannot detect post-translational modifications
ThroughputMedium to high depending on plate formatMedium to high with qPCR plates
Time requirementsTypically 4-6 hours for complete assayCan be completed in 2-4 hours with one-step RT-PCR kits
Equipment needsPlate reader, washing equipmentThermal cycler, gel electrophoresis system or real-time PCR machine
Information providedProtein abundanceTranscriptional activity

Each method offers distinct advantages depending on the research question. ELISA provides direct information about protein levels but cannot assess transcriptional regulation. PCR-based methods reveal transcriptional changes but may not reflect actual protein levels due to post-transcriptional regulation. For comprehensive analysis, combining both approaches is recommended to correlate transcriptional changes with protein expression.

How can researchers optimize Western blot protocols for detecting HAS2 protein in complex biological samples?

Optimizing Western blot protocols for HAS2 detection requires addressing several key considerations:

  • Sample preparation:

    • Use appropriate lysis buffers containing protease inhibitors to prevent degradation

    • For membrane-bound HAS2, include detergents like Triton X-100 or CHAPS to solubilize the protein effectively

    • Maintain cold temperatures during extraction to minimize degradation

  • Protein separation:

    • Use lower percentage (7-8%) SDS-PAGE gels to effectively separate the high molecular weight HAS2 protein

    • Consider gradient gels (4-15%) for better resolution

    • Longer running times may be necessary for proper separation

  • Transfer optimization:

    • Employ wet transfer methods for more efficient transfer of high molecular weight proteins

    • Use transfer buffers containing SDS (0.01-0.02%) to aid in transfer of membrane proteins

    • Extended transfer times (overnight at low voltage) may improve transfer efficiency

  • Blocking and antibody selection:

    • Test different blocking agents (BSA vs. non-fat milk) to determine optimal background reduction

    • Select antibodies validated specifically for chicken HAS2 detection

    • Consider using monoclonal antibodies for higher specificity

    • Optimize primary antibody dilution and incubation conditions (1:500-1:2000, 4°C overnight)

  • Detection enhancement:

    • Employ signal enhancement systems such as biotin-streptavidin amplification if necessary

    • Consider using more sensitive detection reagents for low abundance samples

    • Optimize exposure times to capture signal without saturation

  • Controls and validation:

    • Include positive controls such as recombinant Chicken HAS2 protein

    • Use HAS2 knockdown samples (e.g., siRNA-treated) as negative controls

    • Perform peptide competition assays to confirm antibody specificity

These optimizations will help researchers develop reliable Western blot protocols for detecting HAS2 in complex biological samples, enabling more accurate protein quantification and characterization.

How does HAS2 function relate to embryonic development and tissue patterning in avian models?

HAS2 plays crucial roles in embryonic development and tissue patterning in avian models:

  • Skeletal development: Research has demonstrated that Has2 is essential for proper skeletal growth and patterning. Conditional inactivation of Has2 reveals disruptions in skeletal development, while overexpression results in shortened and severely malformed limbs .

  • Precartilage condensation: Has2 expression and HA production are specifically downregulated in the proximal central core of the limb bud during the formation of precartilage condensations . This downregulation is necessary for the cell-cell interactions that trigger cartilage differentiation.

  • Joint formation: Has2 has been shown to have a crucial role in synovial joint formation in the developing limb . The temporospatial regulation of HA production by HAS2 appears critical for proper joint development.

  • Tissue patterning: Overexpression studies show that sustained production of HA in vivo perturbs limb growth and patterning . This indicates that precise regulation of HAS2 activity is essential for establishing correct tissue architecture.

  • Chondrocyte maturation: Research indicates that HAS2 influences chondrocyte maturation processes, which are critical for proper skeletal development .

These findings collectively demonstrate that HAS2-mediated HA production must be tightly regulated in a temporally and spatially precise manner during embryonic development to ensure proper tissue morphogenesis and patterning in avian models.

What evidence exists for correlations between HAS2 dysregulation and pathological conditions?

Several lines of evidence link HAS2 dysregulation to various pathological conditions:

  • Vascular pathologies: Research indicates that HAS2 induction and formation of HA-rich matrix might be part of lesion-promoting, proinflammatory functions in vascular disease . Specifically, HAS2 expression influences smooth muscle cell phenotype, which can contribute to vascular pathologies.

  • Inflammatory conditions: Dysregulation of HAS2 has been linked to various inflammatory conditions . The ability of prostaglandins to induce HAS2 expression suggests a mechanism by which inflammatory mediators can promote HA synthesis, potentially contributing to disease progression.

  • Cancer progression: HAS2 dysregulation has been implicated in cancer development and progression . The enzyme's role in creating HA-rich matrices can influence tumor cell behavior, including proliferation, migration, and invasion.

  • Tissue injury responses: HAS2 has been linked to tissue injury processes , suggesting its involvement in aberrant healing responses and potential fibrosis.

  • Developmental abnormalities: Overexpression of Has2 in limb development leads to severe skeletal malformations , indicating that dysregulated expression during development can result in significant structural abnormalities.

  • Cell phenotype modulation: HAS2 influences cell spreading and phenotype . In vascular smooth muscle cells, HAS2 expression promotes a proliferative, migratory phenotype, which can contribute to pathological vascular remodeling.

These correlations between HAS2 dysregulation and pathological conditions highlight the potential therapeutic value of targeting HAS2 or its regulatory pathways in various disease contexts.

What emerging technologies might enhance our understanding of HAS2 enzymatic mechanisms?

Several emerging technologies hold promise for advancing our understanding of HAS2 enzymatic mechanisms:

  • Cryo-electron microscopy (Cryo-EM): This technique could provide high-resolution structural information about HAS2 as it functions within the membrane, potentially revealing conformational changes during catalysis that have been difficult to capture with traditional structural biology approaches.

  • Single-molecule enzymology: Technologies that allow observation of individual enzyme molecules could provide insights into the processivity of HAS2 and how it adds monosaccharides to growing hyaluronan chains .

  • CRISPR-based gene editing: Precise modification of specific domains within the HAS2 gene could help identify critical residues involved in substrate binding, catalysis, and product release, enhancing our understanding of structure-function relationships.

  • Microfluidic enzyme assays: These platforms could enable high-throughput analysis of HAS2 activity under various conditions, facilitating detailed enzyme kinetics studies and inhibitor screening.

  • Computational molecular dynamics simulations: As computational power increases, more sophisticated simulations of HAS2 within membrane environments could predict enzyme behavior and guide experimental design.

  • Metabolic labeling and imaging: Novel approaches for visualizing hyaluronan synthesis in real-time could connect HAS2 activity to spatial and temporal aspects of hyaluronan production in living cells.

  • Nanoscale secondary ion mass spectrometry (NanoSIMS): This technique could provide unprecedented spatial resolution for analyzing HAS2 distribution and activity within cellular membranes.

These technologies, particularly when used in combination, have the potential to significantly advance our understanding of the molecular mechanisms governing HAS2 function and regulation.

How might comparative studies across species inform therapeutic applications of HAS2 modulation?

Comparative studies of HAS2 across species offer valuable insights that could inform therapeutic applications:

  • Conserved regulatory mechanisms: By comparing HAS2 regulation across species (chicken, human, and other models), researchers can identify highly conserved regulatory pathways that are likely to be essential for normal function . These conserved elements represent potential therapeutic targets with predictable effects across species.

  • Species-specific differences: Identifying differences in HAS2 regulation between species can highlight adaptations that might inform therapeutic approaches. For example, if certain regulatory mechanisms are unique to humans but absent in other species, these might represent targets for human-specific therapies.

  • Developmental contexts: Comparing HAS2 function during development across species (as in limb development ) can reveal critical periods when HAS2 modulation might be particularly effective or potentially harmful.

  • Disease model relevance: Understanding species differences helps in selecting appropriate animal models for testing HAS2-targeting therapeutics, ensuring that findings translate effectively to human applications.

  • Evolutionary adaptations: Studying HAS2 across evolutionary diverse species can reveal adaptations that might inspire biomimetic approaches to therapeutic design.

  • Structural insights: Comparing HAS2 protein structures across species can identify conserved domains critical for function versus variable regions that might allow for species-selective targeting.

By leveraging these comparative insights, researchers can develop more targeted and effective therapeutic strategies for modulating HAS2 activity in various disease contexts, with better predictions of efficacy and potential side effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.