Recombinant Chicken Insulin-induced gene 1 protein (INSIG1)
Shipped with Ice Packs 
In Stock 
Description
Overview of Recombinant Chicken INSIG1
INSIG1 is a transmembrane protein localized in the endoplasmic reticulum (ER) that regulates cholesterol homeostasis by interacting with SCAP (SREBP cleavage-activating protein) and HMG-CoA reductase . The chicken variant shares functional homology with mammalian INSIG1, playing a role in lipid metabolism and sterol-mediated signaling . Recombinant versions enable species-specific studies in avian models.
Functional Role in Lipid Metabolism
Recombinant chicken INSIG1 retains biological activity, as demonstrated in studies:
-
Cholesterol Regulation:
-
Lipid Synthesis in Poultry:
Table 1: Experimental Uses of Recombinant Chicken INSIG1
Table 2: Recombinant INSIG1 Across Species
Challenges and Limitations
Product Specs
Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate special requirements. Please indicate your desired format in the order notes, and we will prepare the product accordingly.
Note: While we preferentially ship the format we have in stock, we are happy to accommodate special requirements. Please indicate your desired format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time
may vary depending on the purchase method and location. Please consult your local distributors
for specific delivery information.
Note: Our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Note: Our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
INSIG1; RCJMB04_1d1; Insulin-induced gene 1 protein; INSIG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
INSIG1
Target Protein Sequence
MPRLESGAWSCSCAARARHAARPGEAAPKADAMQSPSPSAGRAEREASGGSATTWRQHLV
QRSVVLFVVGAFMALVLNLLQIQRNVTLFPDEVIATLFSSAWWVPPCCGTAAAVVGLLYP
CIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFD
RSRSGLGLGITIAFVATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQ
LAMGIPEKPHND
Uniprot No.
Target Background
Function
Insulin-induced gene 1 (INSIG1) is an oxysterol-binding protein that mediates feedback control of cholesterol synthesis by regulating both endoplasmic reticulum (ER) to Golgi transport of SCAP and degradation of HMGCR. It acts as a negative regulator of cholesterol biosynthesis by mediating the retention of the SCAP-SREBP complex in the ER, thus blocking the processing of sterol regulatory element-binding proteins (SREBPs). INSIG1 binds oxysterol, including 25-hydroxycholesterol, which regulates its interaction with SCAP and the retention of the SCAP-SREBP complex in the ER. In the presence of oxysterol, INSIG1 interacts with SCAP, retaining the SCAP-SREBP complex in the ER, thereby preventing SCAP from escorting SREBPs to the Golgi. Sterol deprivation reduces oxysterol binding, disrupting the interaction between INSIG1 and SCAP, promoting Golgi transport of the SCAP-SREBP complex, followed by processing and nuclear translocation of SREBPs. INSIG1 also regulates cholesterol synthesis by regulating degradation of HMGCR.
Database Links
Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
