Recombinant Chicken Insulin-induced gene 2 protein (INSIG2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken INSIG2 Protein

Recombinant Chicken Insulin-induced gene 2 protein (INSIG2) is a bioengineered variant of the endogenous INSIG2 protein, expressed through bacterial systems such as E. coli. This protein is critical for regulatory lipid metabolism and is produced for research applications in obesity, metabolic disorders, and sterol synthesis studies.

Functional Role in Lipid Metabolism

INSIG2 regulates cholesterol and fatty acid synthesis by inhibiting SREBP processing:

  1. Mechanism: Binds to SCAP, preventing SCAP/SREBP complex transport to the Golgi, thereby blocking SREBP activation .

  2. Regulation:

    • Insulin: Downregulates liver-specific Insig2a transcript in rodents, enabling SREBP1c activation .

    • Vitamin D3: Transiently induces INSIG2 via vitamin D receptor (VDR)-mediated transcription .

    • Hypoxia: Upregulated in pancreatic cancer, linked to malignant potential .

Production Systems

MethodDetailsSource
Recombinant ExpressionE. coli with N-terminal His-tag for purification via metal affinity chromatography
Purity>85% (SDS-PAGE validated)

Applications:

  • ELISA Kits: Used as standard controls in lipid metabolism assays .

  • Biochemical Studies: Investigates INSIG2 interaction with SCAP/SREBP complexes .

  • Obesity Research: Links genetic variants near INSIG2 to obesity susceptibility .

Key Discoveries

  1. Sterol Sensitivity: Unlike INSIG1, INSIG2 requires sterol presence to bind SCAP, enabling precise regulation .

  2. Species-Specific Regulation: Human INSIG2 lacks liver-specific transcripts (Insig2a) present in rodents, affecting insulin responses .

  3. Cancer Connection: Hypoxia-induced INSIG2 correlates with pancreatic cancer aggressiveness .

Comparative Insights

FeatureChicken INSIG2Human INSIG2
Expression SystemE. coli (His-tagged)E. coli (His/Myc-tagged)
RegulationLimited data on insulin responseInsulin-mediated promoter activation
Disease LinksObesity studies (via homologs)Obesity susceptibility loci

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
INSIG2; RCJMB04_5j21; Insulin-induced gene 2 protein; INSIG-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
INSIG2
Target Protein Sequence
MAENDAKPTLPKKSGPYISSVTSRGMNLVIRGIVLFFIGVFLALVLNLLNAVCSGLCQGI NHASAKVDFANNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVSQLLVYNGVY QYTSPDFIYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHED
Uniprot No.

Target Background

Function

INSIG2 is an oxysterol-binding protein that regulates cholesterol biosynthesis through feedback control. It mediates this control by influencing both the endoplasmic reticulum (ER) to Golgi transport of SCAP and the degradation of HMGCR. Acting as a negative regulator of cholesterol biosynthesis, INSIG2 retains the SCAP-SREBP complex within the ER, thereby inhibiting the processing of sterol regulatory element-binding proteins (SREBPs). INSIG2 binds various oxysterols (including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol), modulating its interaction with SCAP and the retention of the SCAP-SREBP complex in the ER. In the presence of oxysterols, INSIG2 interacts with SCAP, preventing the transport of SREBPs to the Golgi. Sterol deprivation reduces oxysterol binding, disrupting the INSIG2-SCAP interaction, which facilitates Golgi transport of the SCAP-SREBP complex, leading to SREBP processing and nuclear translocation. INSIG2 also regulates cholesterol synthesis by modulating HMGCR degradation.

Database Links
Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does chicken INSIG2 differ from mammalian orthologs in experimental applications?

Chicken INSIG2 provides unique advantages in cross-species experimental designs due to evolutionary distance from mammalian systems. When studying highly conserved regulatory pathways, chicken proteins offer distinctive experimental benefits compared to mammalian orthologs. First, chicken INSIG2 maintains core functional domains while exhibiting species-specific variations that can illuminate key structural-functional relationships. Second, using chicken proteins in mammalian systems can provide clearer experimental outcomes since chickens are approximately 100 million years evolutionarily removed from mammals, making their proteins more readily recognized as foreign in mammalian systems .

This evolutionary distance can be particularly advantageous when raising antibodies against INSIG2, as chickens tend to mount more robust immune responses against mammalian proteins that are highly conserved and might otherwise be weakly immunogenic in mammalian hosts . For experimental designs investigating protein-protein interactions or regulatory pathways, the chicken ortholog can provide complementary insights when used alongside mammalian versions, highlighting both conserved mechanisms and species-specific adaptations in lipid regulatory pathways.

What experimental design approaches are most effective for studying INSIG2 function?

When investigating INSIG2 function, true experimental research designs with proper controls yield the most reliable results. The experimental approach should incorporate the following key elements:

  • Control vs. Experimental Groups: Establish clearly defined control and experimental groups with random assignment of samples to minimize bias. For INSIG2 functional studies, include both wild-type controls and specific experimental groups with varied protein concentrations or mutated forms .

  • Variable Manipulation: Systematically manipulate independent variables while measuring dependent variables. For example, when studying INSIG2's role in lipid metabolism, independent variables might include INSIG2 concentration, presence of binding partners, or lipid substrate availability, while dependent variables could include lipid accumulation, gene expression changes, or protein localization patterns .

  • Randomization: Implement proper randomization techniques to control for extraneous variables. This is particularly important in complex cellular assays where multiple factors may influence outcomes .

A robust experimental design for INSIG2 functional studies might include:

GroupTreatmentControl TypeMeasurements
ControlNo INSIG2Negative controlBaseline lipid metabolism
Low-dose0.1 μg/mL INSIG2Dose responseLipid accumulation, gene expression
Medium-dose1.0 μg/mL INSIG2Dose responseLipid accumulation, gene expression
High-dose10 μg/mL INSIG2Dose responseLipid accumulation, gene expression
Mutant INSIG21.0 μg/mL mutated proteinFunctional controlComparative activity analysis

This approach allows for systematic evaluation of dose-dependent effects while controlling for experimental variables that might otherwise confound results .

How should researchers design experiments to investigate INSIG2 protein-protein interactions?

Investigating INSIG2 protein-protein interactions requires careful experimental design with appropriate controls and validation methods. A multi-technique approach is recommended:

  • In vitro binding assays: Using purified recombinant chicken INSIG2 protein, researchers should establish primary interaction profiles through pull-down assays. The His-tag on recombinant chicken INSIG2 facilitates immobilization on Ni-NTA resin for pull-down experiments .

  • Variable manipulation strategy: A factorial experimental design should be implemented, systematically varying factors such as:

    • Protein concentrations (both INSIG2 and potential binding partners)

    • Buffer conditions (pH, salt concentration, detergents)

    • Temperature and incubation times

    • Presence/absence of cofactors or lipid substrates

  • Control implementation: Include multiple controls in each experiment:

    • Non-tagged protein controls to assess tag interference

    • Irrelevant proteins of similar size/structure to test specificity

    • Competitive binding controls with known ligands

    • Denatured protein controls to confirm structural specificity

For co-immunoprecipitation experiments, the chicken origin of INSIG2 provides an additional advantage, as chicken IgY antibodies can be used together with mammalian antibodies in multiplex detection systems without cross-reactivity concerns . This facilitates clearer visualization of protein complexes in co-IP experiments where multiple antibodies are required.

What are the optimal storage and reconstitution protocols for recombinant chicken INSIG2?

Proper storage and reconstitution of recombinant chicken INSIG2 is critical for maintaining protein integrity and experimental reproducibility. Follow these methodological guidelines:

Storage Protocol:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles

  • For short-term use, working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 50% and store at -20°C/-80°C

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For optimal stability, add glycerol to 5-50% final concentration

  • Gently mix by inversion rather than vortexing to prevent protein denaturation

Importantly, repeated freeze-thaw cycles significantly reduce protein activity and should be avoided through proper aliquoting. Working aliquots should be prepared in volumes appropriate for single experiments to prevent waste and quality degradation .

What analytical techniques are most appropriate for validating recombinant chicken INSIG2 function?

Validating the functionality of recombinant chicken INSIG2 requires a multi-faceted analytical approach. The following methodological framework ensures comprehensive functional validation:

  • Structural Integrity Assessment:

    • SDS-PAGE analysis to confirm protein purity (>90% as indicated by standard protocols)

    • Circular dichroism spectroscopy to verify secondary structure elements

    • Limited proteolysis to assess proper folding

  • Functional Assays:

    • Lipid binding assays using fluorescently labeled lipids

    • SREBP cleavage-activating protein (SCAP) binding assays

    • Cholesterol-dependent protein interaction studies

  • Cellular Localization Validation:

    • Immunofluorescence microscopy using anti-His antibodies or specific INSIG2 antibodies

    • Subcellular fractionation followed by Western blotting

    • Co-localization studies with ER markers

For robust experimental design, include appropriate positive and negative controls:

Control TypePurposeImplementation
Positive ControlValidate assay functionalityKnown functional INSIG2 (e.g., human or mouse)
Negative ControlEstablish baseline/backgroundDenatured protein or unrelated transmembrane protein
Tag ControlAssess tag interferenceUntagged protein or alternatively tagged version
Species ControlEvaluate species-specific effectsMammalian INSIG2 proteins for comparison

When comparing functional outcomes across species, the evolutionary distance between chickens and mammals (>100 million years) should be considered as a factor that may influence protein-protein interactions, particularly for conserved metabolic pathways .

How can recombinant chicken INSIG2 be used in multiplex experimental systems?

Recombinant chicken INSIG2 offers unique advantages in multiplex experimental systems due to its species origin and tagged format. When designing multiplex studies, researchers should implement the following methodological approach:

  • Multiplex immunostaining applications: Chicken-derived proteins provide exceptional utility in multiplex detection systems because chicken IgY antibodies can be used alongside mouse and rabbit antibodies without cross-reactivity concerns. Secondary antibodies against chicken IgY do not cross-react with mammalian IgG, enabling clear discrimination in complex co-localization studies .

  • Experimental design for multiplex systems:

    • Establish a true experimental design with appropriate controls

    • Systematically vary independent variables (INSIG2 concentration, lipid levels, presence of interacting proteins)

    • Control for confounding variables through randomization and blocking designs

    • Use factorial experimental designs to assess interaction effects between multiple variables

  • Implementation procedure:

    • Tag visualization: Utilize the His-tag for initial visualization and purification

    • Orthogonal detection methods: Combine fluorescence, chemiluminescence, and colorimetric detection for multiplexed readouts

    • Sequential probing strategies: Develop optimized stripping and reprobing protocols when using multiple antibodies

The advantage of chicken-derived recombinant proteins extends beyond antibody compatibility to include higher immunogenicity when used as antigens in mammalian systems, resulting in stronger experimental signals in many assay formats .

What approaches are recommended for studying the role of INSIG2 in lipid metabolism pathways?

Investigating INSIG2's role in lipid metabolism requires sophisticated experimental design approaches that account for the protein's membrane localization and regulatory functions. Recommended methodological strategies include:

  • Experimental design framework:

    • Implement a controlled variable manipulation design

    • Establish clear independent variables (INSIG2 concentration, lipid availability, cellular stress conditions)

    • Define measurable dependent variables (lipid accumulation, gene expression changes, protein trafficking)

  • Systematic analysis protocol:

    • Begin with in vitro binding studies using purified recombinant chicken INSIG2

    • Progress to cellular models with controlled expression systems

    • Validate key findings in appropriate tissue or organism models

  • Specialized assay methodology:

    • Lipidomic analysis to quantify changes in cellular lipid profiles

    • Real-time monitoring of SREBP pathway activation

    • Proximity ligation assays to detect INSIG2-SCAP interactions in situ

A comprehensive experimental approach should incorporate multiple time points and concentration gradients to capture dynamic regulatory effects:

Experimental ConditionINSIG2 StatusLipid MeasurementGene Expression AnalysisProtein Interaction Study
BasalEndogenous onlyBaseline profilingHousekeeping normalizationBackground interactions
INSIG2 OverexpressionRecombinant additionDifferential analysisPathway-focused arraysCo-IP and mass spectrometry
INSIG2 InhibitionBlocking antibodies or inhibitorsFunctional consequenceRegulatory network mappingDisrupted interaction profiling
Stress ConditionsUnder ER stressStress-responsive changesStress-induced regulationStress-dependent interactions

When using recombinant chicken INSIG2, consider its evolutionary distance from mammalian systems as both an advantage (clearer discrimination of effects) and a potential limitation (species-specific interactions) that should be addressed through appropriate controls .

What are common challenges when working with recombinant INSIG2 and how can researchers address them?

Working with recombinant chicken INSIG2 presents several technical challenges due to its membrane protein nature. Here are methodological approaches to address common issues:

  • Solubility limitations:

    • Challenge: As a transmembrane protein, INSIG2 has hydrophobic regions that can cause aggregation.

    • Solution methodology: Reconstitute lyophilized protein in buffers containing mild detergents (0.1% DDM or 0.5% CHAPS) to maintain solubility. For functional studies, consider reconstitution into nanodiscs or liposomes to provide a membrane-like environment .

  • Protein stability concerns:

    • Challenge: Activity loss during storage or experimental manipulation.

    • Solution methodology: Add glycerol (5-50% final concentration) during reconstitution and strictly avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for no more than one week .

  • His-tag interference:

    • Challenge: The N-terminal His-tag may affect protein function or interactions.

    • Solution methodology: Include parallel experiments with tag-cleaved protein using specific proteases. Alternatively, compare results with differently tagged versions to identify any tag-specific artifacts.

  • Species-compatibility issues:

    • Challenge: Chicken INSIG2 may interact differently with mammalian proteins in certain experimental systems.

    • Solution methodology: Leverage the evolutionary distance (>100 million years) as an experimental advantage. The distinct sequence of chicken INSIG2 can provide clearer results in conserved pathway studies, particularly for immunological applications .

An experimental troubleshooting decision matrix can guide researchers through common issues:

IssueDiagnostic SignFirst InterventionSecondary ApproachValidation Method
Protein AggregationVisible precipitation, high MW bands on gelsOptimize detergent concentrationTry different buffer compositionsDynamic light scattering
Activity LossReduced binding in functional assaysCheck protein concentrationPrepare fresh working stockPositive control comparison
Non-specific BindingHigh background in binding assaysIncrease washing stringencyAdd blocking agents (BSA, milk proteins)Competition assays
Poor ReproducibilityVariable results between experimentsStandardize protein handlingAliquot master stocksStatistical analysis of replicates

How can researchers optimize protein-protein interaction studies involving chicken INSIG2?

Optimizing protein-protein interaction studies with recombinant chicken INSIG2 requires methodological refinements to address its membrane protein nature and evolutionary distinctiveness. Follow this optimization protocol:

  • Buffer optimization strategy:

    • Systematically vary buffer components through a factorial experimental design

    • Test multiple pH conditions (6.5-8.0) to identify optimal interaction conditions

    • Evaluate different ionic strengths (50-500 mM NaCl) to minimize non-specific interactions

    • Incorporate detergent screens (non-ionic, zwitterionic, and mild ionic detergents) to maintain protein solubility without disrupting interactions

  • Experimental design for interaction specificity:

    • Implement a true experimental design with appropriate controls

    • Include competition assays with known binding partners

    • Use concentration gradients to determine binding kinetics

    • Incorporate negative controls with mutated binding interfaces

  • Multiplex detection advantages:

    • Leverage the chicken origin of the protein for multiplex detection systems

    • Chicken-derived proteins and antibodies can be used together with mouse and rabbit detection systems without cross-reactivity concerns

    • This enables more complex co-immunoprecipitation experiments with clearer discrimination of specific interactions

  • Validation methodology:

    • Confirm interactions using multiple orthogonal techniques

    • Start with in vitro pull-down assays using the His-tag

    • Validate with orthogonal methods like surface plasmon resonance

    • Confirm biological relevance with cellular co-localization studies

When optimizing these experiments, consider that the evolutionary distance between chicken and mammalian proteins can be advantageous for studying conserved interactions, as the core functional domains that maintain interactions across species are likely to represent fundamental biological mechanisms .

What emerging techniques show promise for advanced INSIG2 functional studies?

Emerging methodological approaches are expanding the potential for detailed INSIG2 functional characterization. Researchers should consider these innovative techniques:

  • Cryo-electron microscopy applications:

    • High-resolution structural analysis of INSIG2 in membrane environments

    • Visualization of INSIG2-SCAP-SREBP complexes in different conformational states

    • Combining the recombinant chicken INSIG2 with mammalian binding partners can provide unique insights into conserved structural elements versus species-specific adaptations

  • Advanced experimental design approaches:

    • Factorial designs with multiple variables to capture complex regulatory networks

    • Time-series experimental designs to characterize dynamic responses

    • Adaptive experimental designs that evolve based on initial findings

  • CRISPR-based methodologies:

    • Precise genomic engineering to create endogenously tagged INSIG2 variants

    • Development of inducible degradation systems for temporal control of INSIG2 function

    • Creation of chimeric chicken-mammalian INSIG2 variants to map functional domains

  • Innovative protein engineering strategies:

    • Split-protein complementation assays for real-time interaction monitoring

    • Optogenetic control of INSIG2 function through light-responsive domains

    • Bioorthogonal labeling approaches for selective visualization in complex environments

The application of these emerging techniques should follow rigorous experimental design principles, including:

  • Clearly defined independent and dependent variables

  • Appropriate control systems

  • Randomization to minimize bias

  • Sufficient statistical power through adequate replication

When implementing these advanced approaches with recombinant chicken INSIG2, researchers should leverage its unique advantages, including extended shelf life (potentially 5 years or more at 4°C when properly prepared) compared to mammalian alternatives, which typically have more limited stability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.