Recombinant Chicken Integral membrane protein 2B (ITM2B)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant chicken ITM2B is synthesized using multiple platforms to meet research needs:

Expression Platforms:

SystemPurityApplicationsSource
E. coli>90%Structural studies, antibody production
Yeast>90%ELISA, functional assays
Mammalian Cells (HEK293)>95%Cell-based studies, protein interactions

For example, the E. coli-expressed protein (CSB-CF011904CH) includes a His tag and retains functional integrity for biochemical assays .

Functional Roles and Pathways

ITM2B is implicated in critical biological pathways:

Key Functions:

  • Amyloid Regulation: Inhibits amyloid-beta aggregation, a feature conserved across species .

  • Growth Modulation: Differential expression observed in chicken duodenum and jejunum correlates with body weight traits, suggesting roles in nutrient absorption and growth .

  • Protein Interactions: Binds SH3 domains and mRNA, potentially influencing signal transduction and RNA metabolism .

Pathway Involvement:

PathwayAssociated Proteins/GenesRelevance to ITM2B
Diurnal gene regulationCEBPB, KLF9, CRY1Linked to circadian growth patterns in chickens .
APP processingAPP, SPPL2A/SPPL2BModulates APP cleavage, reducing amyloid-beta secretion .

4.1. Growth Trait Associations

A genome-wide association study (GWAS) in chickens identified ITM2B as part of a quantitative trait locus (QTL) influencing body weight. Key findings include:

  • Expression Patterns: ITM2B is upregulated in the duodenum of high-weight chickens, correlating with enhanced nutrient absorption .

  • Regulatory Mutations: Ancestral haplotypes near ITM2B were linked to growth traits, suggesting evolutionary selection in poultry .

Applications in Research

Recombinant chicken ITM2B is utilized in:

  • Amyloid Research: As a control protein to study APP processing inhibitors .

  • Agricultural Genetics: To explore genetic markers for poultry growth optimization .

  • Structural Biology: Crystallization trials using E. coli-derived protein .

Quality and Validation

ParameterSpecification
Purity>90% (SDS-PAGE, Coomassie staining) .
Endotoxin Levels<0.1 ng/μg (LAL test) .
Sterility0.2 μm filtered .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have a specific format requirement, kindly specify it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributor.
As a standard practice, all our proteins are shipped with regular blue ice packs. If you require dry ice shipping, kindly inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For convenient reconstitution, we advise centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. To reconstitute the protein, use deionized sterile water to achieve a concentration ranging from 0.1 to 1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point for your reconstitution process.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ITM2B; Integral membrane protein 2B; Transmembrane protein E3-16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
ITM2B
Target Protein Sequence
MVKVSFNSALAHKEAANKEEENSQVLILPPDAKEPEDVVVPAGHKRAWCWCMCFGLAFMLAGVILGGAYLYKYFAFQQGGVYFCGIKYIEDGLSLPESGAQLKSARYHTIEQNIQILEEEDVEFISVPVPEFADSDPADIVHDFHRRLTAYLDLSLDKCYVIPLNTSVVMPPKNFLELLINIKAGTYLPQSYLIHEQMIVTDRIENVDQLGFFIYRLCRGKETYKLQRKEAMKGIQKREAVNCRKIRHFENRFAMETLICEQ
Uniprot No.

Target Background

Function
Integral membrane protein 2B (ITM2B) plays a crucial role in the induction of neurite outgrowth.
Database Links
Protein Families
ITM2 family
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein. Cell membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed in areas of chondro-osteogenic transition and widely in the nervous system.

Q&A

What is Integral Membrane Protein 2B (ITM2B) and what are its key functions?

ITM2B, also known as BRI2, is a transmembrane protein that undergoes processing at the C-terminus by furin or furin-like proteases to produce a small secreted peptide. This peptide plays a crucial role in inhibiting the deposition of beta-amyloid, which is implicated in Alzheimer's disease pathology. ITM2B participates in multiple biochemical processes including SH3 domain binding, mRNA binding, and poly(A) RNA binding . The protein is particularly significant because mutations that extend the C-terminal end can lead to neurodegenerative conditions such as familial British dementia and familial Danish dementia .

What expression systems are most effective for producing recombinant chicken ITM2B?

Based on current research practices, several expression systems can be employed:

Expression SystemAdvantagesCommon TagsApplications
E. coliHigh yield, economicalHis, GSTStructural studies, antibody production
Mammalian Cells (HEK293)Proper folding, post-translational modificationsFc, DDK, MycFunctional studies, protein-protein interactions
Wheat GermCell-free system, handles difficult proteinsAvi, HisRapid screening
Insect CellsHigh expression of membrane proteinsHis, GSTStructural studies of membrane domains

For studies requiring fully functional protein with appropriate post-translational modifications, mammalian expression systems are generally preferred .

What are the optimal methods for detecting ITM2B expression in experimental systems?

Comprehensive detection strategies include:

  • Western Blotting: Use antibodies against the protein itself or against fusion tags (His, DDK, etc.)

    • Sample preparation: Sonication in RIPA buffer with protease inhibitors

    • Load controls: β-actin for cellular preparations, PonceauS for secreted fractions

  • Immunofluorescence/Immunohistochemistry:

    • Fixation methods: 4% paraformaldehyde preserves membrane structures

    • Permeabilization: 0.1% Triton X-100 allows antibody access while preserving membrane domains

  • qRT-PCR for transcriptional analysis:

    • Design primers spanning exon junctions to avoid genomic DNA amplification

    • Reference genes: GAPDH, β-actin, or 18S rRNA for normalization

How does ITM2B inhibit β-amyloid deposition at the molecular level?

ITM2B employs multiple mechanisms to inhibit β-amyloid deposition:

  • Indirect regulation through IDE: ITM2B increases levels of secreted insulin-degrading enzyme (IDE), which directly degrades β-amyloid peptides, promoting their clearance .

  • Direct inhibition through Bri23 peptide: The 23-amino acid peptide (Bri23) released from ITM2B by normal processing is present in human CSF and directly inhibits Aβ aggregation in vitro .

  • Modulation of APP processing: Studies have demonstrated that BRI2 can interact with APP, though it doesn't appear to alter steady-state levels of APP or APP CTFβ in transgenic models .

Experimental evidence shows that expression of wild-type human BRI2 reduces cerebral Aβ deposition in an AD mouse model without altering endogenous rodent Aβ levels .

What experimental models best demonstrate ITM2B's role in preventing Alzheimer's pathology?

Several experimental models have proven effective:

  • Somatic brain transgenic technology: Viral delivery of BRI2 or BRI2-Aβ1–40 transgenes in APP mouse models (TgCRND8) showed dramatic suppressive effects on parenchymal Aβ1–40 and Aβ1–42 accumulation .

  • Conventional transgenic approaches: Studies crossing BRI2-Aβ transgenic mice with Tg2576 mice have demonstrated reduced Aβ deposition .

  • In vitro aggregation assays: Isolated Bri23 peptide inhibits Aβ aggregation in controlled environments, allowing for mechanistic studies .

For researchers seeking to establish new models, the somatic brain transgenic approach using rAAV1-mediated delivery provides rapid results (3 months) compared to conventional transgenic breeding .

How do mutations in ITM2B contribute to familial British and Danish dementias?

Mutations that extend the C-terminal end of ITM2B alter the size and properties of the secreted peptide, leading to pathological effects:

  • Mutation mechanisms: The extended C-terminal peptides have different aggregation properties compared to the normal Bri23 peptide

  • Experimental approaches to study these mutations:

    • Site-directed mutagenesis to generate specific mutations

    • Expression in cell models to study processing differences

    • Structural studies to determine conformational changes

    • Aggregation assays to assess amyloidogenic potential

  • Methodological considerations:

    • Use pure preparations of mutant proteins to avoid heterogeneity

    • Control for expression levels when comparing wild-type and mutant forms

    • Include appropriate positive controls (known aggregation-prone proteins)

What pathways and protein interaction networks involve ITM2B?

ITM2B participates in several biological pathways and protein interactions:

Pathway/FunctionAssociated ProteinsResearch Applications
Diurnally regulated genes with circadian orthologsAZIN1, EIF4G2, QKI, KLF9, DAZAP2, G0S2, MYF6, CRY1, CEBPB, PURAChronobiological studies, sleep disorders
mRNA bindingHNRPLL, RPS2, PURB, PCF11, TDRD7, EIF4A1, SNRNP70, RPS3, THOC2, NUDT21RNA metabolism, post-transcriptional regulation
SH3 domain bindingLRP2, SH3BGRL2, QKIA, PTTG2, AFAP1L2, SH3BP5L, INPP5J, CCDC6, SH3BP5, SH3BP2Signal transduction pathways
Poly(A) RNA bindingHIST1H1E, RPS19, PDIA3, SBDS, NOA1, CISD2, MYO18A, RBM27, NOL11, HIST1H4HmRNA processing and stability

To investigate these interactions, researchers should employ techniques such as:

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity-dependent biotin labeling (BioID or APEX)

  • Yeast two-hybrid screening

What are common challenges in producing functional recombinant chicken ITM2B?

Researchers frequently encounter several challenges:

  • Protein misfolding: As a transmembrane protein, ITM2B may misfold when expressed recombinantly

    • Solution: Use mammalian expression systems with appropriate chaperones

    • Method: Co-express with calnexin or calreticulin to improve folding

  • Low yield: Membrane proteins often express at lower levels

    • Solution: Optimize codon usage for the expression system

    • Method: Employ fusion tags that enhance solubility (SUMO, MBP)

  • Proteolytic processing: Ensuring proper furin cleavage to generate authentic Bri23 peptide

    • Solution: Verify processing using mass spectrometry

    • Method: Co-express with furin in mammalian systems if necessary

How can researchers resolve data inconsistencies when studying ITM2B functions?

When facing contradictory results:

  • Verify protein identity and integrity:

    • Confirm C-terminal processing using mass spectrometry

    • Validate antibody specificity with knockout controls

  • Control for experimental variables:

    • Standardize expression levels across wild-type and mutant forms

    • Use consistent cellular backgrounds and passage numbers

    • Employ multiple detection methods to confirm observations

  • Address context-dependency:

    • Test in multiple cell types to rule out cell-specific effects

    • Validate in vivo findings with complementary in vitro approaches

What are promising therapeutic applications based on ITM2B's anti-amyloidogenic properties?

Several therapeutic strategies emerge from current understanding:

  • Bri23 peptide mimetics: Developing stable analogues of the Bri23 peptide that retain anti-aggregation properties but have improved pharmacokinetics

  • IDE secretion enhancement: Compounds that upregulate ITM2B or directly enhance IDE secretion could promote Aβ degradation

  • Gene therapy approaches: rAAV1-mediated delivery of BRI2 has shown promise in mouse models and could be developed for clinical applications

  • Structure-based drug design: Targeting the interaction between ITM2B and APP to modulate amyloid processing

These approaches could potentially address not only Alzheimer's disease but also other amyloidopathies.

How might comparative studies between species advance our understanding of ITM2B?

Cross-species analysis offers valuable insights:

  • Evolutionary conservation analysis: Identify highly conserved regions that likely represent critical functional domains

  • Species-specific differences: Compare chicken, human, and rodent ITM2B to identify unique features that may correlate with species-specific amyloid pathology susceptibility

  • Methodological approach:

    • Generate recombinant proteins from multiple species

    • Compare biochemical properties and interaction profiles

    • Test cross-species complementation in knockout models

Such comparative studies may reveal fundamental aspects of ITM2B biology that are not apparent from studying a single species model.

What is the recommended purification protocol for recombinant chicken ITM2B?

For optimal purification of functional protein:

  • Expression system selection: Mammalian HEK293 cells provide proper folding and processing

  • Purification strategy:

    • Solubilize membrane fractions with mild detergents (DDM or CHAPS)

    • Use two-step purification: affinity chromatography followed by size exclusion

    • Verify proper folding using circular dichroism

  • Quality control measures:

    • Confirm C-terminal processing by mass spectrometry

    • Verify activity using Aβ aggregation inhibition assays

    • Test IDE secretion enhancement in cellular models

How can researchers quantitatively assess ITM2B's impact on β-amyloid aggregation?

Robust quantification methods include:

  • Thioflavin T fluorescence assays:

    • Mix purified Aβ peptides with candidate inhibitors

    • Monitor fluorescence over time to track aggregation kinetics

    • Calculate IC50 values to quantify inhibitory potency

  • ELISA-based quantification:

    • Measure soluble vs. insoluble Aβ fractions in cellular or animal models

    • Confirm with immunohistochemical analysis for in vivo studies

  • Surface Plasmon Resonance (SPR):

    • Determine binding kinetics between ITM2B/Bri23 and Aβ

    • Calculate association and dissociation constants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.