Recombinant Chicken Inward rectifier potassium channel 2 (KCNJ2)

Shipped with Ice Packs
In Stock

Description

Gene and Functional Overview

The KCNJ2 gene encodes a tetramerizing potassium channel subunit that forms inwardly rectifying channels. These channels exhibit greater permeability to potassium ions entering the cell than leaving it, a property regulated by extracellular potassium concentration and internal magnesium blockade .

Functional RoleMechanism
Resting Membrane PotentialMaintains hyperpolarized states in neurons, muscle, and cardiac cells
Action Potential RepolarizationContributes to the terminal phase of cardiac action potentials (I<sub>K1</sub> current)
RegulationActivated by PIP2 binding; inhibited by extracellular Ba<sup>2+</sup> or Cs<sup>+</sup>

In chickens, KCNJ2 is expressed in skeletal muscle, heart, and neurons, with roles analogous to its human homolog in maintaining cellular excitability and rhythmic activity .

Key Research Insights

  1. Channel Assembly and Trafficking

    • Human KCNJ2 mutants (e.g., T75R, G144A) exhibit dominant-negative effects on wild-type channels, impairing current amplitude .

    • The chicken protein’s proper membrane trafficking and tetramerization are likely preserved, given its full-length design and His-tagged purification .

  2. Modulation and Pathophysiology

    • Mutations in human KCNJ2 (e.g., Val302del) disrupt potassium conductivity, linking to Andersen-Tawil syndrome .

    • The recombinant chicken KCNJ2 could serve as a model to test small-molecule modulators targeting Kir2.1 channels .

  3. Electrophysiological Studies

    • Inward rectification is mediated by polyamine/magnesium blockade of the pore, as shown in human Kir2.1 .

    • The chicken variant may replicate these properties, enabling studies on voltage-dependent gating and ionic selectivity.

Comparative Analysis with Human KCNJ2

FeatureChicken KCNJ2Human KCNJ2
Expression SystemE. coliNative tissue or mammalian cells
Purification TagHis-tagNative or epitope-tagged
ApplicationsControlled channel studies, protein assaysDisease modeling, drug discovery
Pathological RelevanceN/A (wild-type)Andersen-Tawil syndrome, arrhythmias

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
KCNJ2; IRK1; Inward rectifier potassium channel 2; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
KCNJ2
Target Protein Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLTFILSWLFFGCVFWLIALLHGDLENQENNK PCVSQVSSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDEIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDMDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKNYYKVDYSRFHKTYEVPNTPICSARD LAEKKYILSNANSFCYENEVALTSKEEDEIDTGVPESTSTDTHPDMDHHNQAGVPLEPRP LRRESEI
Uniprot No.

Target Background

Function

Recombinant Chicken Inward rectifier potassium channel 2 (KCNJ2) likely plays a crucial role in establishing action potential waveforms and the excitability of neuronal and muscle tissues. Inward rectifier potassium channels uniquely facilitate potassium influx into cells more readily than efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel opening voltage range to more positive potentials. Inward rectification is primarily attributed to internal magnesium blockade of outward current. External barium can block the channel.

Gene References Into Functions
  1. Molecular dynamics simulations elucidated the structural mechanism of chicken Kir2.2. PMID: 26520451
Database Links

KEGG: gga:396328

STRING: 9031.ENSGALP00000006967

UniGene: Gga.254

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.
Tissue Specificity
Found in the apical basilar papilla of the inner ear, brain, muscle, cerebellum, heart and liver.

Q&A

What is the molecular structure of KCNJ2 and how does chicken KCNJ2 compare to mammalian orthologs?

KCNJ2 encodes inward rectifier potassium channel 2 (Kir2.1), a member of the classical inward-rectifier potassium channel family. Each KCNJ2 monomer contains two transmembrane helix domains (M1 and M2), an ion-selective P-loop between these domains, and cytoplasmic N- and C-terminal domains. The functional channel forms through tetramerization of four subunits .

While the chicken KCNJ2 maintains the conserved structural elements found across species, species-specific variations exist particularly in the intracellular domains. These variations contribute to subtle differences in channel gating, rectification properties, and responses to modulatory factors.

What is the primary physiological role of KCNJ2 in cellular function?

KCNJ2 plays an essential role in maintaining the resting membrane potential and regulating cellular excitability in various cell types . It conducts a strong inward rectifier K+ current, with a greater tendency for K+ uptake than export. In cardiac tissue, KCNJ2 combines with other Kir2 family members (Kir2.2, 2.3, and 2.4) to form channels that drive the transmembrane potassium current IK1, which contributes significantly to the terminal phase of cardiac action potential repolarization and stabilizes the resting membrane potential .

In neuronal tissues and skeletal muscle, KCNJ2 similarly contributes to resting potential maintenance, affecting cellular excitability thresholds and response patterns to stimuli.

How do mutations in KCNJ2 affect channel function and physiological processes?

Mutations in KCNJ2 have been linked to several clinical phenotypes, particularly Andersen-Tawil syndrome (ATS) related to loss-of-function mutations and Short QT Syndrome 3 related to gain-of-function mutations . These genetic alterations disrupt normal channel function through various mechanisms.

For example, studies have identified specific mutations (R67Q, R218L, and G300D) in ATS patients that dramatically alter interaction patterns of the mutated residues, disturbing channel stability . Whole-cell patch-clamp experiments confirmed loss of function in homomeric mutant channels. Other mutations, like M307I located at the intracellular C-terminal domain, affect putative phosphatidylinositol 4,5-bisphosphate (PIP2) binding and channel trafficking .

Some mutations show condition-dependent functional effects, such as the V227F mutation which requires protein kinase A stimulation (a downstream effect of adrenergic stimulation) to manifest the biophysical phenotype of IK1 abnormality associated with arrhythmia .

What are the recommended expression systems for studying recombinant chicken KCNJ2?

For functional studies of recombinant chicken KCNJ2, researchers should consider:

  • Mammalian cell lines: HEK293 or CHO cells provide a mammalian cellular environment with minimal endogenous K+ currents, making them ideal for electrophysiological studies.

  • Xenopus oocytes: This system allows for robust expression and is particularly suitable for two-electrode voltage clamp studies of channel properties.

The choice depends on specific research questions:

  • Use mammalian cells for studies of trafficking, protein-protein interactions, and cellular regulation

  • Use Xenopus oocytes for initial characterization of biophysical properties and pharmacological responses

For each expression system, optimization of transfection conditions specifically for chicken KCNJ2 is essential, as avian proteins may have different expression efficiency compared to mammalian orthologs.

What electrophysiological approaches are most effective for characterizing KCNJ2 function?

Whole-cell patch-clamp electrophysiology represents the gold standard for functional characterization of KCNJ2 channels . Key experimental parameters should include:

  • Voltage protocols: Apply hyperpolarizing and depolarizing voltage steps to assess rectification properties characteristic of Kir channels

  • Current-voltage relationships: Generate I-V curves to quantify rectification strength and reversal potential

  • Channel blockers: Use Ba2+ (micromolar range) as a specific blocker to confirm KCNJ2 identity

  • Modulatory conditions: Test channel function under various conditions, including different [K+] concentrations and following application of signaling pathway activators (e.g., PKA activators)

For more detailed biophysical characterization, single-channel recordings provide insights into conductance properties and gating kinetics.

What computational approaches complement experimental studies of KCNJ2?

Computational modeling provides critical insights into structure-function relationships of KCNJ2. An effective approach includes:

  • Full-length structural modeling: Develop models for both open and closed conformations of the channel

  • Site-directed mutagenesis analysis: Identify altered interaction profiles contributing to structural perturbations

  • Molecular dynamics simulations: Assess the impact of mutations on channel conformation and stability

  • Principal component analysis: Reveal mutation-specific structural perturbations in channel dynamics

  • Normal mode analysis: Identify dominant modes of motion affected by mutations

This multi-faceted computational approach provides atomic-level characterization of mutation-specific perturbations that may not be directly observable through experimental methods alone.

How can researchers effectively design mutation studies to understand KCNJ2 function?

When designing KCNJ2 mutation studies, researchers should implement a comprehensive strategy:

  • Select mutations strategically: Focus on highly conserved regions including transmembrane segments (M1 and M2), the extracellular pore loop, and intracellular termini

  • Generate both homomeric and heteromeric channels: Since functional channels are tetramers, expressing various ratios of wild-type and mutant subunits mimics the heterozygous state often found in patients

  • Assess dominant-negative effects: Many KCNJ2 mutations exert dominant-negative effects on wild-type subunits, crucial for understanding clinical phenotypes

  • Compare closed and open states: Introduce mutations in both conformational states to comprehensively assess functional impacts

  • Correlate with clinical phenotypes: Connect biophysical abnormalities to clinical manifestations, particularly for mutations showing condition-dependent effects like the PKA-dependent V227F mutation

This systematic approach enables researchers to establish clear structure-function relationships and disease mechanisms.

What approaches can researchers use to study the regulation of KCNJ2 by post-translational modifications?

KCNJ2 function is dynamically regulated by several post-translational mechanisms:

  • Phosphorylation studies: Use site-directed mutagenesis to modify potential phosphorylation sites and assess their functional impact. Protein kinase A phosphorylation has been shown to modulate KCNJ2 function, particularly affecting certain mutations like V227F

  • PIP2 interaction analysis: Examine the critical role of phosphatidylinositol 4,5-bisphosphate in channel activity, particularly relevant for mutations in the C-terminal domain that affect PIP2 binding

  • Ubiquitination and SUMOylation: Investigate how these modifications affect channel trafficking and degradation using inhibitors of specific modification pathways

  • Mass spectrometry: Identify actual modification sites on natively expressed or recombinant KCNJ2

  • Phosphomimetic mutations: Create mutations that mimic permanent phosphorylation (e.g., serine/threonine to aspartate/glutamate) or prevent phosphorylation (serine/threonine to alanine)

This multi-faceted approach reveals how signaling pathways dynamically regulate KCNJ2 function in different physiological contexts.

How can recombinant chicken KCNJ2 be used for comparative electrophysiology studies?

Comparative studies between chicken and mammalian KCNJ2 offer valuable insights:

ParameterExperimental ApproachExpected Information
Biophysical propertiesWhole-cell patch-clampSpecies differences in conductance, rectification, and gating
Pharmacological sensitivityDose-response studiesDifferential responses to blockers and modulators
Temperature sensitivityRecordings at various temperaturesAdaptations related to avian vs. mammalian physiology
Protein-protein interactionsCo-immunoprecipitation, FRETSpecies-specific interacting partners
RegulationResponse to signaling pathway activatorsDivergence in regulatory mechanisms

These comparative studies can reveal evolutionary adaptations in channel function that correlate with species-specific physiological demands, such as differences in metabolic rate and body temperature between birds and mammals.

What statistical approaches are most appropriate for analyzing KCNJ2 electrophysiological data?

Robust statistical analysis of KCNJ2 electrophysiological data requires:

  • Normalization strategies: Current densities (pA/pF) should be calculated to account for cell size variability

  • Paired statistical tests: Use paired t-tests or Wilcoxon signed-rank tests for before/after interventions on the same cells

  • Multiple comparison corrections: Apply Bonferroni or Tukey corrections when comparing multiple experimental conditions

  • Non-parametric methods: Consider non-parametric tests (Mann-Whitney, Kruskal-Wallis) when data do not follow normal distribution

  • Regression analysis: For dose-response relationships or time-dependent effects

  • Power analysis: Determine appropriate sample sizes based on expected effect sizes and variability

While analyzing mutation effects, researchers should account for expression level differences that might confound interpretation of functional changes.

How should researchers address heterogeneity in KCNJ2 channel composition?

KCNJ2 can form both homomeric channels and heteromeric channels with other Kir2 family members , creating challenges for data interpretation:

  • Single-cell analysis: Quantify cell-to-cell variability rather than relying solely on population averages

  • Biophysical fingerprinting: Use characteristic rectification properties to identify the likely subunit composition

  • Dominant-negative approaches: Express engineered dominant-negative constructs to selectively suppress specific subunit contributions

  • Mathematical modeling: Develop computational models that predict the properties of channels with different subunit compositions

  • Controlled heteromeric expression: Co-express defined ratios of different channel subunits for systematic study

This approach helps distinguish the functional contributions of different channel populations that may coexist in the same experimental preparation.

What are key considerations when interpreting molecular dynamics simulation data for KCNJ2?

When analyzing molecular dynamics (MD) simulation data for KCNJ2:

  • Conformational stability: Root Mean Square Deviation (RMSD) and Root Mean Square Fluctuation (RMSF) evaluations show that the open conformation state of the channel is typically more stable compared to the closed state

  • Interaction networks: Analyze hydrogen bonds, salt bridges, and hydrophobic interactions that stabilize the channel structure

  • Collective motions: Apply Principal Component Analysis to identify the dominant modes of motion and how they're affected by mutations

  • Energy landscapes: Calculate free energy profiles for ion permeation and conformational changes

  • Simulation limitations: Consider the timescale limitations of MD simulations when interpreting results, particularly for slow conformational changes

  • Validation with experimental data: Always correlate computational findings with experimental electrophysiology to ensure biological relevance

This comprehensive analysis approach provides atomic-level insights into channel dynamics that explain functional phenotypes observed experimentally.

How can researchers address common technical difficulties with recombinant KCNJ2 expression?

When encountering challenges with chicken KCNJ2 expression and function:

  • Low expression levels: Optimize codon usage for the expression system, try different promoters, and adjust transfection protocols specifically for avian genes

  • Trafficking issues: Co-express chaperone proteins that may facilitate proper folding and membrane targeting

  • Protein degradation: Include proteasome inhibitors to determine if rapid degradation affects expression levels

  • Functional verification: Confirm channel identity using specific blockers like barium and characteristic rectification properties

  • Expression tags: Consider the impact of epitope or fluorescent tags on channel function; C-terminal tags are generally preferable to N-terminal tags for Kir channels

These strategies help overcome common technical barriers while ensuring that the expressed channels maintain native-like properties.

What control experiments are essential when studying modulatory effects on chicken KCNJ2?

Rigorous control experiments are critical for studying KCNJ2 modulation:

  • Time-matched controls: Account for potential rundown or changes in channel properties over time

  • Vehicle controls: Include all solvents used for modulatory compounds

  • Positive controls: Include known modulators with established effects

  • Specificity controls: Test modulators on cells lacking KCNJ2 expression to rule out effects on endogenous channels

  • Dose-response relationships: Establish complete dose-response curves rather than testing single concentrations

  • Washout experiments: Demonstrate reversibility of modulatory effects

  • Mutation controls: For PKA-dependent effects, test both phosphorylation-mimetic and phosphorylation-resistant mutations

These controls ensure that observed effects are specific to the channel and the modulator being studied, rather than experimental artifacts.

How can researchers resolve contradictory findings in KCNJ2 functional studies?

When faced with contradictory results:

  • Expression system differences: Systematically compare channel function in different cell types to identify context-dependent effects

  • Recording condition variations: Standardize solutions, temperature, and voltage protocols across experiments

  • Channel composition: Account for potential differences in homo- vs. heteromeric channel composition

  • Post-translational modifications: Assess the phosphorylation state and other modifications that might differ between preparations

  • Replication with increased sample size: Increase statistical power to detect subtle but consistent effects

  • Complementary techniques: Combine electrophysiology with biochemical and imaging approaches to corroborate findings

  • Computational validation: Use molecular modeling to provide mechanistic explanations for apparently contradictory results

This systematic approach helps reconcile divergent findings and develop a more complete understanding of channel function across different experimental contexts.

What emerging technologies show promise for advancing KCNJ2 research?

Several cutting-edge approaches are poised to transform KCNJ2 research:

  • Cryo-EM structures: High-resolution structures of chicken KCNJ2 in different conformational states would provide unprecedented insights into channel gating mechanisms

  • Genome editing in avian models: CRISPR/Cas9 modification of the native KCNJ2 gene in chicken models to study physiological roles in vivo

  • Single-molecule FRET: Real-time monitoring of conformational changes in individual KCNJ2 channels

  • Automated patch-clamp platforms: High-throughput functional screening of mutations and modulatory compounds

  • Artificial intelligence approaches: Machine learning algorithms to predict mutation effects based on channel sequence and structure

These technologies will enable more comprehensive understanding of KCNJ2 function across species and provide new opportunities for therapeutic targeting of channel dysfunction.

How can 3D genome organization studies enhance understanding of KCNJ2 regulation?

Recent advances in 3D genome mapping technologies offer new insights into KCNJ2 regulation:

  • Haplotype-resolved Hi-C: Technologies for building haplotype-resolved 3D genome maps can reveal allele-specific chromatin architecture affecting KCNJ2 expression

  • Enhancer-promoter interactions: Identify long-range regulatory elements controlling tissue-specific expression of KCNJ2

  • Chromatin conformation changes: Study how developmental stages or physiological stimuli alter the 3D genomic context of KCNJ2

  • Transcription factor binding: Correlate binding patterns with 3D chromatin organization and expression levels

  • Species-specific regulatory differences: Compare regulatory landscapes between chicken and mammalian KCNJ2 to identify evolutionary divergence in expression control

These approaches connect genetic variation to channel expression patterns, providing a more complete picture of how KCNJ2 dysfunction contributes to disease phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.