Recombinant Chicken LETM1 and EF-hand domain-containing protein 1, mitochondrial (LETM1)

Shipped with Ice Packs
In Stock

Description

Introduction to LETM1

The Leucine Zipper EF-Hand Containing Transmembrane Protein 1 (LETM1) is a mitochondrial protein that plays a crucial role in maintaining mitochondrial function and calcium homeostasis. While specific information on "Recombinant Chicken LETM1" is limited, understanding the general functions and characteristics of LETM1 can provide valuable insights into its role in cellular processes.

Structure and Function of LETM1

LETM1 is localized to the inner mitochondrial membrane and is known for its Ca²⁺/H⁺ exchanger activity, which helps regulate mitochondrial calcium levels . The protein contains EF-hand domains, which are calcium-binding motifs. These domains are crucial for sensing calcium and facilitating the protein's regulatory functions within the mitochondria .

Key Features of LETM1:

  • EF-Hand Domains: LETM1 contains both canonical and non-canonical EF-hand domains. The canonical domain has a typical Ca²⁺-binding loop with conserved residues, while the non-canonical domain lacks these features .

  • Leucine Zipper: This motif is involved in protein-protein interactions, potentially contributing to LETM1's role in mitochondrial complex assembly .

  • Transmembrane Domains: LETM1 spans the mitochondrial inner membrane, facilitating its role in ion exchange .

Role in Mitochondrial Function

LETM1 is essential for maintaining mitochondrial health by regulating calcium and proton homeostasis, which affects ATP production and mitochondrial morphology . It interacts with other mitochondrial proteins to ensure proper assembly and function of respiratory complexes .

Impact on Cellular Processes:

  • Apoptosis and Metabolism: LETM1 influences cellular metabolism and apoptosis, with its dysregulation linked to various diseases .

  • Cancer: LETM1 is overexpressed in several cancers, suggesting a role in tumorigenesis .

Research Findings

Recent studies have highlighted the importance of LETM1 in mitochondrial dynamics and cellular signaling. The protein's EF-hand domains are critical for its function as a calcium sensor and in modulating its interactions with other proteins .

Recent Discoveries:

  • Structural Dynamics: The apo form of LETM1's EF-hand domain adopts a closed conformation, which changes upon calcium binding, facilitating its sensing capabilities .

  • pH Sensitivity: LETM1 exhibits pH sensitivity, with certain residues having pKa values close to physiological pH, allowing it to respond to pH fluctuations .

Potential Applications and Future Research

Understanding LETM1's structure and function can lead to insights into mitochondrial diseases and cancer. Further research is needed to explore its therapeutic potential, especially in conditions related to mitochondrial dysfunction.

Future Directions:

  • Therapeutic Targets: LETM1 could serve as a target for therapies aimed at regulating mitochondrial calcium homeostasis and metabolism .

  • Cancer Research: Investigating LETM1's role in cancer progression may reveal novel strategies for cancer treatment .

Data Tables

While specific data tables for "Recombinant Chicken LETM1" are not available, general information on LETM1 can be summarized as follows:

FeatureDescription
LocationInner mitochondrial membrane
FunctionCa²⁺/H⁺ exchanger, mitochondrial calcium regulation
DomainsEF-hand (canonical and non-canonical), leucine zipper, transmembrane domains
Role in DiseaseLinked to Wolf-Hirschhorn syndrome, cancer, and metabolic disorders

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LETM1; RCJMB04_13i11; Mitochondrial proton/calcium exchanger protein; Leucine zipper-EF-hand-containing transmembrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
113-752
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
LETM1
Target Protein Sequence
DDSIVEKSLKSLKDKNKKLEEGGPVYSPTEVEVVKKSIGQRIVDELKHYYHGFRLLWIDT KIAARMLWRILHGNTLSRRERRQFLRICADLFRLVPFLVFLVVPFMEFLLPVALKLFPNM LPSTFETKSKKEERLKKQLRVKLELAKFLQDTIEEMALKNKAAKGNVTKDFSTFFQKIRE TGERPSNEEILRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRTI KADDKMIAEEGVDSLTVKELQAACRARGMRALGVTEERLREQLKQWLDLHLNQEIPTSLL ILSRAMYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAEVEGEKVDNKARLEATLQEEAA IRKENEEKEMERITEAAEKAKETLQVAAMKLESAVDLEPAVLQVKESQVAMDSKQELAKA DMETLKDTAPVLEGIKGEEITKEEIDMLSDACNKLQEQKKSLTKEKEELEELKGDIQEYN EDLQEIKELSKAGQEEVVEESKASKRLTKRVNRMIGQIDKIINELETNQKTVDVKLDRGD SPPAGENLISIAELINAMKQIQKIPEEKLTRIAEALDENKDGKIDIDNVVKVVELIDKED VDIGTSQVAEIMALLQKEEKLEEKEKAKEKQDKEAAEVKN
Uniprot No.

Target Background

Function
Mitochondrial proton/calcium antiporter mediating proton-dependent calcium efflux from mitochondria. Essential for maintaining tubular shape and cristae organization.
Database Links
Protein Families
LETM1 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.