Recombinant Chicken Lysocardiolipin acyltransferase 1 (LCLAT1)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant Chicken LCLAT1 is produced using heterologous expression systems such as E. coli or mammalian cells. Key features include:

PropertyDetails
Host SystemE. coli, Yeast, Baculovirus, or Mammalian Cells
TagHis-tag (commonly used for purification)
Protein LengthPartial or full-length (1-378 amino acids in chickens)
Molecular Weight~42–45 kDa (predicted based on sequence homology)
Purity≥85% (validated by SDS-PAGE)

The enzyme is a multi-pass membrane protein localized to the endoplasmic reticulum, consistent with its role in lipid biosynthesis .

Functional Analysis

LCLAT1 catalyzes the reacylation of lysocardiolipin to cardiolipin (CL), a mitochondrial phospholipid essential for energy metabolism . Its activities include:

ActivitySubstratesAcyl Donor Preference
Acyl-CoA:lysocardiolipin acyltransferaseMonolysocardiolipin, dilysocardiolipinLinoleoyl-CoA, oleoyl-CoA
Lysophosphatidylinositol acyltransferaseLysophosphatidylinositol (LPI)Polyunsaturated fatty acids
Lysophosphatidylglycerol acyltransferaseLysophosphatidylglycerol (LPG)Not specified

Biological Roles

  • Cardiolipin Remodeling: Essential for maintaining mitochondrial membrane integrity and respiratory chain function .

  • Developmental Regulation: Required for hematopoietic and endothelial lineage specification in vertebrates .

  • Disease Associations:

    • Dysregulation linked to idiopathic pulmonary fibrosis in humans (via TGF-β signaling) .

    • Orthologs in mice show cardiac and hepatic expression, suggesting conserved roles in energy-demanding tissues .

Comparative Studies

  • Species Conservation: Chicken LCLAT1 shares 65–70% sequence identity with human and mouse variants, preserving catalytic residues critical for acyltransferase activity .

  • Functional Redundancy: Zebrafish LCLAT1 knockout models exhibit defective hematopoiesis, mirroring findings in mammalian systems .

Applications in Research

Recombinant Chicken LCLAT1 is utilized in:

  • Lipidomics Studies: To investigate cardiolipin remodeling in avian mitochondrial disorders.

  • Drug Discovery: Screening inhibitors targeting lipid metabolism pathways .

  • Comparative Biochemistry: Elucidating evolutionary divergence in lipid biosynthesis mechanisms .

Future Directions

Current gaps include structural characterization of the chicken isoform and its regulatory mechanisms. Advanced studies using cryo-EM or X-ray crystallography could resolve these questions, leveraging recombinant protein tools .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
LCLAT1; AGPAT8; LYCAT; RCJMB04_5b22; Lysocardiolipin acyltransferase 1; 1-acylglycerol-3-phosphate O-acyltransferase 8; 1-AGP acyltransferase 8; 1-AGPAT 8; Acyl-CoA:lysocardiolipin acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
LCLAT1
Target Protein Sequence
MVSWKGIYFVVALFLGSFFGSIFMLGPFLPLMFISPAWYRWITDRIVATWLTLPVALLEM VFGAKVVVTGDGFIPGERSVIIMNHRTRMDWMFLWNCLLRYSYLRLEKICLKSSLKSIPG FGWAMQVAAFIFIQRKWEDDKSHFENMLHYFCDIHEPLQLLIFPEGTDLTANTKARSNDF AEKNGLRKYEYVLHPRTTGFTFVVECLREGNNLDAIHDITVAYPQNIPQTEKHLLNGNFP KEIHFHVQRYPIETVPTSKEELQLWCQKRWEEKEERLRRFYEGGKCFDETGQSIIPPCKS ELRVLAVKCISLLYWTVFPMGTFALLYLYSFARWYFAAMIIIFVAQQKIFGGLELIELAC HQYFKKQQKHDDTKMKKK
Uniprot No.

Target Background

Function
Recombinant Chicken Lysocardiolipin acyltransferase 1 (LCLAT1) exhibits acyl-CoA:lysocardiolipin acyltransferase (ALCAT) activity. It catalyzes the reacylation of lyso-cardiolipin to cardiolipin (CL), a key step in CL remodeling. LCLAT1 recognizes both monolysocardiolipin and dilysocardiolipin as substrates, with a preference for linoleoyl-CoA and oleoyl-CoA as acyl donors. It also possesses 1-acyl-sn-glycerol-3-phosphate acyltransferase activity (AGPAT) activity, converting 1-acyl-sn-glycerol-3- phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3- phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Furthermore, LCLAT1 exhibits both lysophosphatidylinositol acyltransferase (LPIAT) and lysophosphatidylglycerol acyltransferase (LPGAT) activities. This enzyme is essential for establishing the hematopoietic and endothelial lineages.
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Lysocardiolipin Acyltransferase 1 (LCLAT1) and what are its alternative names?

Lysocardiolipin Acyltransferase 1 (LCLAT1) is an acyltransferase enzyme that plays a crucial role in phospholipid metabolism, particularly in the remodeling of cardiolipin and phosphatidylinositol. In the scientific literature, LCLAT1 is also referred to by several alternative names, including LYCAT, AGPAT8, LPLAT6, and ALCAT1 (acyl-CoA:lysocardiolipin acyltransferase 1) . These multiple designations reflect the enzyme's discovery in different contexts and its various biochemical functions. The enzyme catalyzes the reacylation of lysocardiolipin species, contributing to the maintenance of specific fatty acyl chain compositions that are critical for proper cellular function, particularly in mitochondria and membrane signaling processes .

What are the primary substrates and functions of LCLAT1?

LCLAT1 primarily functions as an acyltransferase that recognizes specific substrates within phospholipid remodeling pathways. Its main substrates include monolysocardiolipin and dilysocardiolipin, with a notable preference for linoleoyl-CoA and oleoyl-CoA as acyl donors . The enzyme exhibits substrate specificity, as it does not significantly catalyze acyltransferase activities against glycerol-3-phosphate or various other lysophospholipids such as lysophosphatidylcholine, lysophosphatidylethanolamine, and lysophosphatidylserine .

LCLAT1's primary functions include:

  • Cardiolipin remodeling: It catalyzes the reacylation of lysocardiolipin species after hydrolysis by phospholipase A, contributing to the maintenance of specific cardiolipin compositions essential for mitochondrial function .

  • Phosphatidylinositol acyl chain regulation: It contributes to the specific acyl profiles of phosphatidylinositol and phosphoinositides, influencing membrane properties and signaling functions .

  • Development regulation: In developmental contexts, LCLAT1 (as LYCAT) can influence the specification of hematopoietic and endothelial cell lineages, potentially acting at the level of the hemangioblast .

How is LCLAT1 expressed in different tissues?

Expression patterns of LCLAT1 vary across tissues, with particular enrichment in specific organs and cell types. Northern blot analysis of mouse ALCAT1 (LCLAT1) has shown widespread distribution throughout various tissues, with notably higher expression levels in the heart and liver tissues . This tissue-specific expression pattern suggests specialized roles in these metabolically active organs.

At the cellular level, LCLAT1 (as LYCAT) is enriched in specific stem cell populations. In mouse models, LYCAT is particularly abundant in Lin−C-Kit+Sca-1+ hematopoietic stem cells found in bone marrow and in the Flk1+/hCD4+(Scl+) hemangioblast population within embryoid bodies . This enrichment in stem and progenitor cell populations aligns with LCLAT1's role in developmental processes and lineage specification.

The conservation of the LCLAT1 gene across vertebrate species, but not in non-atrium organisms, further supports its specialized role in tissues with high energy demands, particularly in maintaining cardiac function .

What cellular compartments contain LCLAT1?

LCLAT1 exhibits specific subcellular localization that is integrally connected to its biochemical functions. Immunocytohistochemical analysis has demonstrated that ALCAT1 (LCLAT1) is primarily localized to the endoplasmic reticulum (ER) . This ER localization has been further substantiated by the detection of significant ALCAT activity in isolated liver and heart microsomes, which are vesicular fragments of the endoplasmic reticulum .

This localization pattern is particularly significant because it reveals a previously unrecognized role for the endoplasmic reticulum in cardiolipin metabolism. Traditionally, cardiolipin was thought to be exclusively processed within mitochondria, where it functions as a critical component. The identification of LCLAT1 as an ER-resident enzyme involved in cardiolipin remodeling implies a more complex interorganelle coordination in phospholipid metabolism than previously understood .

What structural features characterize LCLAT1?

While specific structural information about chicken LCLAT1 is limited in the provided search results, comparative analysis with other acyltransferases provides insights into its likely structural characteristics. LCLAT1 belongs to a family of acyltransferases but is distinct from the membrane-bound O-acyltransferases (MBOAT) class of acyltransferases such as Rasp and Porc .

In related acyltransferases, specific motifs are critical for function. For instance, in the chicken histone acetyltransferase-1 (chHAT-1), a leucine zipper motif is essential for protein-protein interactions . While chHAT-1 is a different enzyme, this highlights the importance of specific structural motifs in acyltransferase function and interactions.

LCLAT1's structure enables it to recognize specific substrates (monolysocardiolipin and dilysocardiolipin) and acyl donors (linoleoyl-CoA and oleoyl-CoA), suggesting the presence of defined binding domains that facilitate these specific interactions . The enzyme's substrate specificity indicates structural features that distinguish it from other acyltransferases that might act on different lysophospholipids.

What expression systems are optimal for recombinant chicken LCLAT1?

For optimal expression of recombinant chicken LCLAT1, researchers should consider multiple expression systems based on the experimental goals and required protein characteristics. Both insect and mammalian cell expression systems have demonstrated success with LCLAT1 homologs. In pioneering studies with mouse ALCAT1, both insect cells and mammalian cells effectively expressed the recombinant protein with retained enzymatic activity .

A methodological approach should include:

  • Vector selection: For mammalian expression, vectors containing strong promoters like CMV or EF1α are recommended. For insect cell expression, baculovirus-based systems with polyhedrin or p10 promoters typically yield high expression levels.

  • Cell line consideration:

    • For mammalian expression: HEK293 or CHO cells offer robust expression with proper post-translational modifications

    • For insect expression: Sf9 or High Five cells provide high yields of recombinant protein

  • Expression verification system: Incorporate epitope tags (His, FLAG, or GST) to facilitate both detection and purification. The GST fusion approach has been successfully employed with related proteins such as chHAT-1 .

  • Optimization parameters: Critical parameters include temperature (typically reduced to 28-30°C for mammalian cells after induction), induction time (24-72 hours), and media supplementation with specific lipids that may stabilize the enzyme.

For quantitative assessment of expression, researchers should employ activity assays measuring acyltransferase function with monolysocardiolipin and dilysocardiolipin substrates, as the enzymatic activity correlates directly with recombinant LCLAT1 levels .

What are the key considerations for purifying recombinant chicken LCLAT1?

Purification of recombinant chicken LCLAT1 requires specific strategies to maintain structural integrity and enzymatic activity. Based on approaches used for similar acyltransferases, a comprehensive purification protocol should incorporate the following key considerations:

  • Membrane protein extraction: As LCLAT1 is an ER-localized enzyme , effective solubilization requires careful selection of detergents. Consider a gradient approach:

    • Initial screening with mild detergents (0.5-1% CHAPS, DDM, or digitonin)

    • Optimization of detergent concentration to balance solubilization efficiency and protein stability

    • Inclusion of glycerol (10-15%) to stabilize the protein during extraction

  • Affinity chromatography: For tagged recombinant LCLAT1:

    • His-tagged constructs: Ni-NTA columns with imidazole gradient elution (20-250 mM)

    • GST-tagged constructs: Glutathione Sepharose with reduced glutathione elution

    • Multiple constructs may be created to determine optimal tag position (N- or C-terminal)

  • Buffer optimization:

    • Maintain pH between 7.0-8.0 (typically HEPES or Tris-based)

    • Include reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation

    • Consider lipid supplementation (0.01-0.05% cardiolipin) to stabilize the enzyme

    • Add protease inhibitors throughout purification

  • Activity preservation: At each purification step, verify enzymatic activity using acyltransferase assays with monolysocardiolipin and dilysocardiolipin substrates .

For highest purity, a multi-step approach combining affinity chromatography with size exclusion and/or ion exchange chromatography is recommended. All purification steps should be conducted at 4°C to minimize protein degradation.

How can researchers verify the activity of purified recombinant LCLAT1?

Verification of recombinant chicken LCLAT1 activity requires specific assays that evaluate its acyltransferase function. A comprehensive activity verification approach should include:

  • Substrate-specific acyltransferase assays:

    • Primary assay: Measure acyl-CoA:monolysocardiolipin acyltransferase and acyl-CoA:dilysocardiolipin acyltransferase activities using radiolabeled or fluorescently-labeled acyl-CoA donors (preferably linoleoyl-CoA and oleoyl-CoA, as these are preferred substrates)

    • Negative control assays: Test activity against non-substrate lysophospholipids (lysophosphatidylcholine, lysophosphatidylethanolamine, lysophosphatidylserine) and glycerol-3-phosphate, which should show minimal activity

  • Enzyme kinetics analysis:

    • Determine Km and Vmax for both monolysocardiolipin and dilysocardiolipin

    • Assess acyl-CoA donor preference by comparing reaction rates with different acyl-CoA species

    • Measure the dependence of enzymatic activity on protein concentration to establish linearity

  • Activity verification under various conditions:

    • pH dependence (range 6.0-9.0)

    • Divalent cation requirements (Mg2+, Mn2+, Ca2+)

    • Temperature stability profile (4-45°C)

    • Inhibitor sensitivity

  • Product verification:

    • Analyze reaction products using thin-layer chromatography, HPLC, or mass spectrometry to confirm the formation of reacylated cardiolipin species

    • Compare the fatty acyl profile of generated cardiolipin with expected patterns

Activity measurements should demonstrate that the recombinant enzyme exhibits the expected substrate preferences and that activity levels correlate with enzyme concentration, as observed with mouse ALCAT1 where enzymatic activity exhibited dependence upon ALCAT1 enzyme levels .

What are common challenges in expressing recombinant chicken LCLAT1?

Researchers working with recombinant chicken LCLAT1 may encounter several technical challenges that require specific troubleshooting approaches. Based on experience with similar acyltransferases, these challenges typically include:

  • Low expression yields:

    • Challenge: Membrane-associated acyltransferases often express at lower levels than soluble proteins

    • Solution: Optimize codon usage for the expression system; employ fusion partners (SUMO, thioredoxin) to enhance solubility; test inducible promoters with variable induction strengths

  • Protein misfolding and aggregation:

    • Challenge: ER-resident proteins like LCLAT1 may misfold when overexpressed

    • Solution: Reduce expression temperature (16-28°C); co-express molecular chaperones; add chemical chaperones (glycerol, trehalose) to culture media; consider using a native signal sequence

  • Enzymatic activity loss during purification:

    • Challenge: Detergents required for solubilization may disrupt enzymatic activity

    • Solution: Screen detergent panels at minimal effective concentrations; incorporate stabilizing lipids; use protein engineering to enhance stability

  • Post-translational modification discrepancies:

    • Challenge: Recombinant systems may not replicate native post-translational modifications

    • Solution: Select expression systems closely related to the native context; verify activity regardless of modification state; compare mammalian and insect expression systems

  • Substrate availability:

    • Challenge: Specialized substrates like monolysocardiolipin and dilysocardiolipin may be difficult to source

    • Solution: Develop synthetic routes or enzymatic preparation methods; establish collaborations with specialized lipid laboratories

  • Protein-protein interaction deficiencies:

    • Challenge: Recombinant protein may lack necessary binding partners

    • Solution: Consider co-expression of potential interaction partners; supplement with tissue extracts during activity assays

A systematic approach to these challenges includes establishing multiple expression constructs (varying tags, fusion partners, and expression systems) and implementing a staged optimization process that addresses each challenge sequentially while monitoring both protein yield and enzymatic activity.

What domains are critical for LCLAT1 function?

The functional domains of LCLAT1 determine its substrate specificity and enzymatic activity. While detailed structural information about chicken LCLAT1 is limited in the provided search results, analysis of related acyltransferases provides insights into likely critical domains:

  • Acyltransferase catalytic domain:

    • Contains the active site responsible for transferring acyl groups from acyl-CoA donors to lysocardiolipin acceptors

    • Likely includes conserved histidine and aspartate/glutamate residues for catalysis

    • Mutations in this domain would directly affect enzymatic activity measurements with monolysocardiolipin and dilysocardiolipin substrates

  • Substrate binding regions:

    • Specialized pockets that confer specificity for monolysocardiolipin and dilysocardiolipin over other lysophospholipids

    • Regions that interact preferentially with linoleoyl-CoA and oleoyl-CoA as acyl donors

    • These regions can be identified through substrate competition assays and site-directed mutagenesis

  • Membrane interaction domains:

    • Hydrophobic regions that facilitate association with the endoplasmic reticulum membrane

    • May include specific targeting sequences that direct the protein to the ER

    • Could potentially be identified through deletion studies and subcellular localization analysis

  • Protein-protein interaction motifs:

    • Based on related acyltransferases, these might include leucine zipper motifs similar to those found in chHAT-1

    • Such motifs could mediate interactions with other proteins involved in phospholipid metabolism

    • Verification would require pulldown assays, yeast two-hybrid screens, or co-immunoprecipitation studies

Systematic domain mapping through truncation mutants and chimeric constructs would enable researchers to delineate the specific regions responsible for each aspect of LCLAT1 function, following approaches similar to those used for structure-function analysis of related enzymes like chHAT-1 .

How does substrate specificity differ between chicken LCLAT1 and mammalian orthologs?

Comparative analysis of chicken LCLAT1 and its mammalian orthologs reveals important differences in substrate specificity that have significant implications for experimental design. While direct comparative data is limited in the provided search results, a methodological approach to this question would involve:

  • Substrate preference analysis:

    • Mammalian LCLAT1 (ALCAT1) demonstrates preference for monolysocardiolipin and dilysocardiolipin as substrates, with linoleoyl-CoA and oleoyl-CoA as preferred acyl donors

    • Comparative enzymatic assays with chicken LCLAT1 should quantify:

      • Relative Km and Vmax values for different lysocardiolipin species

      • Relative efficiency with various acyl-CoA donors, particularly comparing saturated vs. unsaturated and chain-length preferences

      • Rate comparison with non-preferred substrates

  • Acyl chain incorporation patterns:

    • Analyze the final acyl composition of cardiolipin after remodeling by chicken vs. mammalian LCLAT1

    • Mass spectrometry profiling of reaction products would reveal species-specific preferences

    • Expected differences may correlate with the distinct membrane composition requirements of avian vs. mammalian mitochondria

  • Expression pattern differences:

    • Mammalian LCLAT1 shows highest expression in heart and liver tissues

    • Comparative tissue distribution analysis across species using quantitative PCR and Western blotting

    • Correlation of expression patterns with tissue-specific cardiolipin compositions

  • Temperature-dependent activity profiles:

    • Given the higher body temperature of birds (41°C) compared to mammals (37°C), temperature-activity relationships should be assessed

    • Enzyme stability and optimal activity temperature may differ between orthologs

A comprehensive substrate specificity comparison would enable researchers to determine whether the enzymatic properties of chicken LCLAT1 reflect species-specific adaptations in cardiolipin metabolism, particularly related to the higher metabolic rates and body temperatures in avian species.

What experimental approaches can determine the structure-function relationship of LCLAT1?

Elucidating the structure-function relationship of chicken LCLAT1 requires a multi-faceted experimental approach combining structural biology with functional analysis. A comprehensive methodology should include:

  • Structural determination techniques:

    • X-ray crystallography of purified recombinant LCLAT1, potentially with substrate analogs or in complex with binding partners

    • Cryo-electron microscopy for visualization of membrane-associated conformations

    • NMR spectroscopy for dynamic structural information, particularly for substrate binding regions

    • Molecular modeling based on homologous acyltransferases with known structures

  • Systematic mutagenesis approaches:

    • Alanine scanning mutagenesis of conserved residues to identify those critical for catalysis

    • Domain swapping between chicken LCLAT1 and other acyltransferases to identify regions conferring substrate specificity

    • Point mutations targeting potential active site residues, evaluated through enzymatic assays with monolysocardiolipin and dilysocardiolipin substrates

  • Functional correlation studies:

    • Structure-guided mutations followed by enzymatic activity assays

    • Subcellular localization analysis of mutants to assess ER targeting requirements

    • Substrate binding assays using fluorescence-based approaches or surface plasmon resonance

    • Assessment of how mutations affect substrate preferences for different acyl-CoA donors

  • In silico analysis:

    • Molecular dynamics simulations to model substrate binding and catalytic mechanisms

    • Evolutionary analysis of conserved residues across species to identify functionally critical regions

    • Protein-protein interaction predictions to identify potential binding interfaces

  • Biophysical characterization:

    • Circular dichroism spectroscopy to assess secondary structure and thermal stability

    • Limited proteolysis to identify stable domains and flexible regions

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions during substrate binding

This integrated approach would provide comprehensive insights into how specific structural features of chicken LCLAT1 contribute to its enzymatic function, substrate specificity, and cellular localization, following precedents established for structure-function analysis of related acyltransferases .

How do mutations in specific domains affect LCLAT1 activity?

Mutations in specific domains of LCLAT1 can significantly impact its enzymatic activity, substrate specificity, and cellular function. A methodological approach to this question involves systematic mutational analysis and comprehensive functional assessment:

  • Catalytic domain mutations:

    • Mutations in predicted catalytic residues would likely abolish or severely reduce enzymatic activity

    • Expected outcome: Decreased acyltransferase activity with monolysocardiolipin and dilysocardiolipin substrates

    • Methodological approach: Measure kinetic parameters (Km, Vmax, kcat) for wildtype vs. mutant enzymes

  • Substrate binding region mutations:

    • Mutations altering the binding pocket geometry would affect substrate specificity

    • Expected outcome: Shifted preference between monolysocardiolipin vs. dilysocardiolipin, or altered acyl-CoA donor preferences from the typical linoleoyl-CoA and oleoyl-CoA preference

    • Methodological approach: Competitive substrate assays with multiple lysocardiolipin species and acyl-CoA donors

  • Membrane association domain mutations:

    • Alterations in hydrophobic regions would affect ER localization

    • Expected outcome: Mislocalization from the normal ER distribution , potentially leading to reduced access to substrates

    • Methodological approach: Immunocytochemistry and subcellular fractionation studies

  • Protein interaction motif mutations:

    • Mutations in interaction domains would disrupt protein-protein associations

    • By analogy with related proteins like chHAT-1, mutations in motifs such as leucine zipper domains could abolish protein interactions

    • Methodological approach: Co-immunoprecipitation, GST pull-down assays, or yeast two-hybrid analysis

  • Structure-guided mutation strategy:

    • Conservative mutations (maintaining chemical properties) vs. non-conservative mutations

    • Charge reversal mutations to test electrostatic interactions

    • Insertion/deletion mutations to assess spacing requirements

A systematic mutational analysis would generate a comprehensive map of structure-function relationships in chicken LCLAT1, providing insights into:

  • Critical residues for catalysis

  • Determinants of substrate specificity

  • Requirements for proper cellular localization

  • Regions mediating protein-protein interactions

These results would guide targeted enzyme engineering for enhanced activity or altered substrate specificity in experimental applications.

How can researchers use recombinant LCLAT1 to study cardiolipin remodeling?

Recombinant chicken LCLAT1 serves as a powerful tool for investigating cardiolipin remodeling processes, which are critical for maintaining mitochondrial function. A comprehensive methodological approach includes:

  • In vitro remodeling system establishment:

    • Reconstitute purified recombinant LCLAT1 with defined lipid substrates (monolysocardiolipin and dilysocardiolipin)

    • Supply various acyl-CoA donors (particularly linoleoyl-CoA and oleoyl-CoA, as preferred substrates)

    • Monitor reaction progress using mass spectrometry or radiolabeled substrates

    • This controlled system allows precise quantification of remodeling kinetics and substrate preferences

  • Remodeling pathway reconstitution:

    • Combine recombinant LCLAT1 with phospholipases that generate lysocardiolipin substrates

    • Create a sequential enzyme system that mimics the complete remodeling pathway

    • Analyze intermediates to map the remodeling process step-by-step

    • This approach enables identification of rate-limiting steps in the remodeling pathway

  • Comparative analysis across species:

    • Compare chicken LCLAT1 activity with mammalian orthologs

    • Correlate enzymatic differences with species-specific cardiolipin profiles

    • This comparative approach reveals evolutionary adaptations in cardiolipin metabolism

  • Structural requirements investigation:

    • Use recombinant enzyme with modified substrates to determine structural requirements for remodeling

    • Systematically vary acyl chain length, saturation, and head group structure

    • This structure-activity relationship analysis defines the molecular constraints of remodeling

  • Metabolic pathway integration:

    • Combine recombinant LCLAT1 with other enzymes in cardiolipin metabolism

    • Study cross-talk between de novo synthesis and remodeling pathways

    • This systems approach reveals regulatory mechanisms controlling cardiolipin homeostasis

By employing recombinant LCLAT1 in these experimental contexts, researchers can establish a detailed molecular understanding of cardiolipin remodeling processes, expanding upon the foundational work that identified ALCAT1 as the first cardiolipin-remodeling enzyme discovered in any living organism .

What role does LCLAT1 play in mitochondrial function studies?

LCLAT1 serves as a critical investigative tool in mitochondrial function studies due to its role in cardiolipin remodeling, which directly impacts mitochondrial performance. A methodological approach to utilizing LCLAT1 in mitochondrial research includes:

  • Mitochondrial membrane integrity assessment:

    • Recombinant LCLAT1 can be used to generate cardiolipin profiles with specific acyl compositions

    • These defined cardiolipins can then be incorporated into model membranes or isolated mitochondria

    • Subsequent measurements of membrane potential, permeability, and protein complex stability reveal how cardiolipin composition affects mitochondrial membrane properties

    • This approach clarifies why cardiolipin is required for the reconstituted activity of key mitochondrial enzymes involved in energy metabolism

  • Respiratory chain complex function analysis:

    • LCLAT1-dependent alteration of cardiolipin composition directly affects oxidative phosphorylation efficiency

    • Experimental design: Modify cardiolipin in isolated mitochondria using recombinant LCLAT1 and measure:

      • Complex I-V activities using spectrophotometric assays

      • Oxygen consumption rates with substrate-specific respirometry

      • ATP production efficiency

    • This methodology reveals how cardiolipin acyl chain composition influences respiratory chain function

  • Mitochondrial dynamics investigation:

    • LCLAT1 activity affects cardiolipin distribution in mitochondrial membranes

    • Monitor fusion/fission events and cristae morphology after LCLAT1-mediated remodeling

    • Correlate altered dynamics with mitochondrial function

    • This approach links cardiolipin remodeling to physical mitochondrial dynamics and morphology

  • Stress response mechanisms:

    • Apply oxidative stressors to systems with modified LCLAT1 activity

    • Measure cardiolipin oxidation, remodeling rates, and mitochondrial function

    • This reveals how cardiolipin remodeling responds to and mediates stress adaptation

  • Mitochondrial-ER contact site investigation:

    • LCLAT1's localization in the ER while generating cardiolipin (primarily found in mitochondria) suggests a role in organelle contact sites

    • Visualization techniques can track cardiolipin movement between organelles

    • This approach illuminates the emerging understanding of interorganelle coordination in phospholipid metabolism

These methodologies leverage LCLAT1 as both an analytical tool and an experimental variable to uncover the fundamental relationships between cardiolipin composition, mitochondrial structure, and bioenergetic function.

How can recombinant LCLAT1 be used to investigate developmental biology?

Recombinant LCLAT1 offers unique opportunities for investigating developmental processes, particularly in hematopoietic and endothelial lineage specification. A methodological framework for these developmental studies includes:

  • Stem cell differentiation modulation:

    • Based on findings that mouse LYCAT (LCLAT1) influences hemangioblast development , recombinant chicken LCLAT1 can be used to:

      • Modify phospholipid composition in differentiating stem cells

      • Analyze subsequent changes in differentiation potential and lineage commitment

      • Measure expression of key developmental genes like Flk1, Tie2, Gata1, Gata2, Runx1, and Scl

    • This approach clarifies how membrane lipid composition influences developmental signaling

  • Hemangioblast specification analysis:

    • Recombinant LCLAT1 can be employed to alter cardiolipin and phosphatidylinositol profiles in blast colony-forming cells (BL-CFCs)

    • Subsequent measurement of:

      • Blast colony formation efficiency

      • Differentiation potential toward hematopoietic vs. endothelial lineages

      • Gene expression profiles using quantitative RT-PCR for mesoderm/hemangioblast genes (Flk1, Bmp4, Bmp7)

    • This methodology reveals how LCLAT1-dependent lipid modifications influence early lineage decisions

  • Signaling pathway modulation:

    • LCLAT1-mediated phosphatidylinositol remodeling affects phosphoinositide-dependent signaling

    • Experimental approach: Modify phosphoinositide acyl chains using recombinant LCLAT1 and measure:

      • Receptor tyrosine kinase signaling efficiency

      • MAPK and PI3K pathway activation

      • Transcription factor binding to developmental gene promoters

    • This approach connects lipid remodeling to developmental signal transduction

  • Embryoid body differentiation system:

    • Using the established embryoid body (EB) model system where mouse LYCAT influences hematopoietic and endothelial development :

      • Supplement EBs with recombinant LCLAT1 at different time points

      • Analyze cell type specification using lineage-specific markers

      • Perform functional assays for endothelial and hematopoietic progenitors

    • This time-course methodology establishes the developmental windows when LCLAT1 activity is most critical

These approaches leverage recombinant LCLAT1 as a tool to manipulate the phospholipid environment during development, providing mechanistic insights into how lipid remodeling influences cell fate decisions during embryonic development and stem cell differentiation.

What techniques can be used to study LCLAT1 interactions with other proteins?

Investigating LCLAT1's protein interaction network requires sophisticated techniques that can identify, validate, and characterize specific binding partners. A comprehensive methodological approach includes:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged recombinant chicken LCLAT1 (GST, FLAG, or His tag)

    • Perform pulldown experiments from cellular lysates

    • Identify co-purifying proteins by mass spectrometry

    • Distinguish specific interactions from background using appropriate controls

    • This unbiased approach identifies novel interaction partners across the proteome

  • Yeast two-hybrid screening:

    • Use LCLAT1 as bait to screen cDNA libraries

    • Validate positive interactions with complementary methods

    • Perform domain mapping with truncation mutants

    • This approach has been successful with related proteins, as demonstrated by the yeast two-hybrid assay revealing that leucine zipper motifs are necessary for protein interactions in related acyltransferases

  • GST pull-down assays:

    • Express GST-LCLAT1 fusion proteins

    • Incubate with potential interaction partners

    • Analyze binding using truncated and missense mutants to map interaction domains

    • This approach, similar to that used for chHAT-1 , allows detailed mapping of interaction surfaces

  • Bioluminescence resonance energy transfer (BRET):

    • Tag LCLAT1 and potential partners with appropriate donors and acceptors

    • Measure energy transfer in living cells

    • Assess interaction dynamics in response to metabolic changes

    • This technique captures interactions in their native cellular environment

  • Co-immunoprecipitation with domain mapping:

    • Express full-length and truncated LCLAT1 variants

    • Immunoprecipitate from cellular lysates

    • Identify minimal regions required for interaction

    • This approach defines the specific domains mediating each protein-protein interaction

  • Proximity labeling techniques:

    • Fuse LCLAT1 to BioID or APEX2

    • Identify proteins in close proximity within cells

    • Distinguish direct vs. indirect interactions

    • This method captures transient and weak interactions in the native context

By applying these complementary techniques, researchers can build a comprehensive interaction map for chicken LCLAT1, potentially revealing connections to other phospholipid remodeling enzymes, mitochondrial proteins, or developmental regulators. This multifaceted approach extends beyond simple identification to characterize the functional significance of each interaction.

How can researchers resolve inconsistent activity in recombinant LCLAT1 assays?

Inconsistent activity in recombinant LCLAT1 assays represents a common technical challenge that requires systematic troubleshooting. A methodological approach to resolving such inconsistencies includes:

  • Enzyme stability assessment:

    • Monitor protein stability over time using SDS-PAGE and Western blotting

    • Implement thermal shift assays to identify destabilizing conditions

    • Test stabilizing additives:

      • Glycerol (10-20%)

      • Reducing agents (DTT, β-mercaptoethanol)

      • Cardiolipin or phosphatidylinositol at low concentrations

    • Develop optimized storage conditions (temperature, buffer composition)

  • Substrate quality control:

    • Implement rigorous quality checks for lysocardiolipin substrates:

      • Verify purity by thin-layer chromatography or mass spectrometry

      • Confirm substrate stability under assay conditions

      • Prepare fresh substrate solutions for each experiment

    • For acyl-CoA donors, verify:

      • CoA esterification status

      • Absence of oxidation (particularly for polyunsaturated species)

      • Appropriate solubilization without micelle formation

  • Assay condition optimization:

    • Systematically vary and document:

      • Buffer composition (HEPES, Tris, phosphate)

      • pH (range 6.5-8.5)

      • Ionic strength (50-200 mM)

      • Divalent cation concentration (Mg2+, Mn2+)

      • Detergent type and concentration

    • Establish standard curves for each new batch of enzyme and substrate

    • Monitor reaction linearity with respect to time and enzyme concentration

  • Detection method validation:

    • Compare multiple detection methods:

      • Radiometric assays with [14C]-labeled acyl-CoA

      • Fluorescence-based assays

      • HPLC or LC-MS methods

    • Implement internal standards for quantification

    • Validate each method against known standards

  • Expression system variation:

    • Compare enzyme preparations from different expression systems (insect vs. mammalian cells)

    • Assess post-translational modification status

    • Evaluate the impact of different purification methods

By implementing this systematic troubleshooting approach, researchers can identify the specific factors causing inconsistent activity and establish robust, reproducible assay conditions for recombinant LCLAT1. Documentation of these optimization steps will provide valuable methodological guidance for future studies.

What controls are essential when analyzing LCLAT1 function?

Proper experimental controls are critical for reliable analysis of LCLAT1 function. A comprehensive control strategy should include:

  • Enzyme-specific controls:

    • Positive control: Well-characterized batch of active recombinant LCLAT1 with established specific activity

    • Negative control: Heat-inactivated enzyme (95°C for 10 minutes)

    • Catalytic mutant control: LCLAT1 with mutations in predicted catalytic residues

    • Expression background control: Purification product from expression system without LCLAT1 transgene

    • These controls verify that observed activity is specifically attributable to functional LCLAT1

  • Substrate specificity controls:

    • Non-substrate controls: Test activity against glycerol-3-phosphate and non-substrate lysophospholipids (lysophosphatidylcholine, lysophosphatidylethanolamine, lysophosphatidylserine)

    • Acyl-CoA specificity controls: Compare activity with various acyl-CoA donors beyond the preferred linoleoyl-CoA and oleoyl-CoA

    • Substrate competition assays: Measure activity in the presence of multiple potential substrates

    • These controls confirm the enzyme's substrate specificity profile

  • Reaction condition controls:

    • Time-course analysis: Verify reaction linearity during the assay period

    • Enzyme concentration dependence: Confirm proportional activity increase with enzyme concentration

    • Buffer-only control: Complete reaction mixture without enzyme

    • Substrate-only controls: Reactions missing either lysocardiolipin or acyl-CoA

    • These controls ensure that measured activity reflects enzymatic catalysis under appropriate conditions

  • Cellular localization controls:

    • Subcellular fractionation markers: For ER (calnexin), mitochondria (VDAC), cytosol (GAPDH)

    • Non-specific binding controls: When using immunocytochemistry or fluorescent tagging

    • Negative control cells: Without LCLAT1 expression

    • These controls verify the expected endoplasmic reticulum localization

  • Developmental/functional controls:

    • Non-manipulated control cells: For comparison with LCLAT1-overexpressing or knockdown cells

    • Rescue controls: Re-expression of LCLAT1 in knockdown systems

    • Vector-only controls: When using expression constructs

    • These controls establish causality between LCLAT1 levels and observed phenotypes

Implementing this comprehensive control strategy ensures that experimental observations can be reliably attributed to LCLAT1 function, distinguishing specific enzymatic activities from background processes or non-specific effects.

How can researchers interpret contradictory data regarding LCLAT1 activity?

Interpreting contradictory data regarding LCLAT1 activity requires a systematic analytical approach that considers multiple variables affecting enzyme function. A methodological framework for resolving such contradictions includes:

By applying this systematic analytical framework, researchers can transform seemingly contradictory data into a more nuanced understanding of LCLAT1 function under different conditions, potentially revealing regulatory mechanisms or context-dependent activity profiles.

What are common pitfalls in experimental design when studying LCLAT1?

Researchers studying LCLAT1 should be aware of several common experimental design pitfalls that can compromise data quality and interpretation. A comprehensive awareness of these challenges includes:

  • Substrate-related pitfalls:

    • Insufficient substrate purity: Contaminated lysocardiolipin preparations may contain inhibitors or alternative substrates

      • Solution: Implement rigorous quality control using HPLC or mass spectrometry

    • Inappropriate substrate concentrations: Too low (non-saturating) or too high (micelle formation)

      • Solution: Perform substrate titration to establish appropriate concentration ranges

    • Neglecting acyl-CoA specificity: Failing to test multiple acyl-CoA donors beyond the preferred linoleoyl-CoA and oleoyl-CoA

      • Solution: Include comprehensive acyl-CoA panels in activity assessments

  • Enzyme preparation pitfalls:

    • Activity loss during purification: Detergents or buffer conditions may inactivate the enzyme

      • Solution: Monitor activity at each purification step

    • Neglecting protein-lipid requirements: Removing essential lipids during purification

      • Solution: Consider purification strategies that maintain the lipid environment

    • Tag interference: Affinity tags affecting enzyme activity or localization

      • Solution: Compare multiple tag positions and cleavable tag designs

  • Localization analysis pitfalls:

    • Overexpression artifacts: Non-physiological localization due to saturation of targeting machinery

      • Solution: Use inducible expression systems with titratable expression levels

    • Misinterpreting partial colocalization: Assuming complete overlap with ER markers

      • Solution: Employ quantitative colocalization analysis and super-resolution microscopy

  • Developmental study pitfalls:

    • Developmental stage confusion: Testing LCLAT1 function at inappropriate developmental windows

      • Solution: Implement precise temporal control of LCLAT1 manipulation

    • Indirect effects misattribution: Attributing secondary effects to direct LCLAT1 activity

      • Solution: Establish cause-effect relationships through rescue experiments and time-course analyses

    • Neglecting redundant pathways: Failing to consider compensatory mechanisms

      • Solution: Employ combinatorial approaches targeting multiple pathways

  • Comparative analysis pitfalls:

    • Species-specific differences: Applying mammalian LCLAT1 findings directly to chicken LCLAT1

      • Solution: Always validate findings across species with direct experimental comparison

    • Isoform confusion: Failing to distinguish between splicing variants or closely related enzymes

      • Solution: Use isoform-specific detection methods and genetic models

By anticipating these common pitfalls, researchers can design more robust experiments with appropriate controls, valid interpretation frameworks, and greater reproducibility when studying chicken LCLAT1 and related acyltransferases.

What are emerging areas of LCLAT1 research?

LCLAT1 research is expanding into several innovative directions that promise to deepen our understanding of this enzyme's roles in cellular metabolism and development. Emerging research areas include:

  • Single-cell phospholipidomics integration:

    • Combining LCLAT1 functional studies with single-cell phospholipid profiling

    • Correlating cell-to-cell variability in LCLAT1 activity with phospholipid compositional heterogeneity

    • Investigating how this variability contributes to cellular differentiation decisions

    • This approach will reveal how LCLAT1-mediated lipid remodeling contributes to cellular heterogeneity and fate determination

  • Organelle contact site dynamics:

    • Exploring LCLAT1's role at ER-mitochondria contact sites, given its ER localization and involvement in mitochondrial lipid metabolism

    • Investigating how LCLAT1 might facilitate cardiolipin transfer between organelles

    • Examining the regulation of LCLAT1 activity during mitochondrial biogenesis

    • This research will clarify the emerging understanding of interorganelle communication in phospholipid metabolism

  • Developmental metabolomics:

    • Integrating LCLAT1 activity measurements with comprehensive metabolomic profiling during development

    • Tracking temporal changes in cardiolipin and phosphatidylinositol profiles during lineage specification

    • Correlating these changes with developmental gene expression patterns

    • Building upon findings that LYCAT influences hematopoietic and endothelial development

  • Structural biology advancements:

    • Applying cryo-electron microscopy to determine LCLAT1 structure in membrane environments

    • Understanding how membrane association influences enzyme conformation and activity

    • Developing structure-based inhibitors or activators as research tools

    • This structural work will provide mechanistic insights into LCLAT1's substrate specificity and catalytic mechanism

  • Stress response and adaptation mechanisms:

    • Investigating how LCLAT1 activity responds to cellular stressors

    • Examining the enzyme's role in lipid remodeling during adaptation to changed environments

    • Exploring potential post-translational modifications that regulate LCLAT1 during stress

    • This research will connect LCLAT1 to broader cellular stress response networks

These emerging research directions are extending LCLAT1 studies beyond basic enzymatic characterization toward understanding its integrated roles in cellular physiology, development, and adaptation to environmental challenges.

How might LCLAT1 research contribute to understanding mitochondrial disorders?

LCLAT1 research offers significant potential for advancing our understanding of mitochondrial disorders through several mechanistic pathways. A comprehensive framework for this contribution includes:

  • Cardiolipin abnormality mechanisms:

    • LCLAT1's role in cardiolipin remodeling directly connects to disorders like Barth syndrome

    • Research opportunities include:

      • Comparing LCLAT1 activity in normal vs. disease models

      • Testing whether LCLAT1 modulation can normalize cardiolipin profiles in disease states

      • Investigating interactions between LCLAT1 and tafazzin (mutated in Barth syndrome)

    • This approach may reveal whether altered LCLAT1 activity contributes to or compensates for primary cardiolipin defects

  • Mitochondrial membrane integrity regulation:

    • LCLAT1-mediated changes in cardiolipin composition affect mitochondrial membrane properties

    • Research applications include:

      • Assessing how LCLAT1 activity influences mitochondrial permeability transition

      • Examining the impact on respiratory supercomplex stability

      • Measuring effects on mitochondrial fragility during isolation

    • These studies can explain membrane-related pathologies in mitochondrial disorders

  • Oxidative stress response mechanisms:

    • Cardiolipin oxidation is a key feature of mitochondrial dysfunction

    • LCLAT1 research opportunities include:

      • Investigating how the enzyme responds to oxidized cardiolipin species

      • Testing whether LCLAT1 contributes to cardiolipin repair after oxidative damage

      • Examining potential protective roles in neurodegeneration models

    • This research may identify new therapeutic targets for oxidative stress-related mitochondrial disorders

  • Developmental mitochondrial dysfunction:

    • LCLAT1's developmental roles may inform understanding of mitochondrial disorders with developmental onset

    • Research avenues include:

      • Tracking mitochondrial function during differentiation with normal vs. altered LCLAT1 activity

      • Examining tissue-specific consequences of LCLAT1 dysfunction

      • Investigating potential developmental windows for intervention

    • These studies can explain why certain mitochondrial disorders manifest at specific developmental stages

  • Interorganelle communication defects:

    • ER-mitochondria communication is increasingly recognized in mitochondrial disease pathogenesis

    • LCLAT1's ER localization suggests research directions:

      • Examining how LCLAT1 dysfunction affects lipid transfer between organelles

      • Testing whether ER stress alters LCLAT1-dependent cardiolipin remodeling

      • Investigating calcium signaling at ER-mitochondria contact sites with altered LCLAT1 function

    • This approach may reveal new disease mechanisms involving interorganelle communication defects

These research directions demonstrate how LCLAT1 studies can provide mechanistic insights into mitochondrial disorders, potentially leading to novel diagnostic approaches or therapeutic strategies targeting lipid remodeling pathways.

What techniques are being developed to study LCLAT1 in real-time?

Emerging technologies are enabling increasingly sophisticated real-time analysis of LCLAT1 activity and its impact on cellular lipid dynamics. These cutting-edge methodological approaches include:

  • Fluorescent lipid probes for live-cell imaging:

    • Development of cardiolipin-specific fluorescent probes with spectral shifts upon remodeling

    • Implementation of FRET-based biosensors that detect changes in acyl chain composition

    • Application of environment-sensitive probes that respond to alterations in membrane properties

    • These tools enable visualization of LCLAT1-mediated lipid remodeling in living cells with subcellular resolution

  • Genetically encoded biosensors:

    • Engineering of fusion proteins linking LCLAT1 with conformationally-sensitive fluorescent proteins

    • Development of split fluorescent protein systems to detect LCLAT1 interactions with binding partners

    • Creation of sensors that detect local changes in lysocardiolipin or acyl-CoA concentrations

    • These approaches allow real-time monitoring of LCLAT1 activity, localization, and interaction dynamics

  • Mass spectrometry innovations:

    • Adaptation of MALDI-imaging mass spectrometry for spatial mapping of LCLAT1-dependent lipid changes

    • Development of microfluidic sampling systems for temporal profiling of phospholipid remodeling

    • Implementation of stable isotope labeling strategies to track newly remodeled lipids

    • These techniques provide spatiotemporal information about LCLAT1 activity with molecular specificity

  • Optogenetic control systems:

    • Engineering of light-activatable LCLAT1 variants using photosensitive protein domains

    • Development of optochemical tools for precise temporal control of LCLAT1 activity

    • Creation of spatially restricted activation systems for subcellular targeting

    • These approaches enable precise manipulation of LCLAT1 activity with both spatial and temporal control

  • Microfluidic enzyme assay platforms:

    • Design of continuous-flow systems for real-time monitoring of enzyme kinetics

    • Development of droplet-based assays for high-throughput analysis of LCLAT1 variants

    • Implementation of gradient generators to simultaneously test multiple reaction conditions

    • These platforms allow rapid optimization and characterization of recombinant LCLAT1 preparations

  • Correlative microscopy approaches:

    • Integration of fluorescence microscopy with mass spectrometry imaging

    • Combination of live-cell imaging with subsequent electron microscopy

    • Development of workflows linking functional observations to structural analysis

    • These correlative techniques connect LCLAT1 activity to structural and compositional changes

These advanced methodological approaches are transforming LCLAT1 research from static endpoint measurements to dynamic analyses that capture the enzyme's activity and its consequences in real-time, providing unprecedented insights into the spatiotemporal regulation of phospholipid remodeling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.