Recombinant Chicken Lysophosphatidic acid receptor 6 (LPAR6)

Shipped with Ice Packs
In Stock

Description

Structure and Functional Characteristics

LPAR6 is a 344-amino acid transmembrane receptor with a molecular mass of ~39.4 kDa. While originally classified as a purinergic receptor (P2Y5), it was reclassified as an LPA receptor due to its binding affinity for oleoyl-L-alpha-lysophosphatidic acid (LPA) . Key features include:

  • Sequence Homology: High conservation in transmembrane domains across vertebrates, including mammals and avians .

  • Signaling Pathways: Couples to Gα12/13, Gs, and Gi proteins, triggering calcium mobilization, cAMP modulation, and Rho-dependent cytoskeletal changes .

  • Ligand Specificity: Activated by 2-acyl-LPA (e.g., oleoyl-LPA) at micromolar concentrations, though weaker than other LPA receptors (e.g., LPA1–5) .

Hair Follicle Development

LPAR6 is essential for hair growth regulation. Mutations in LPAR6 cause hypotrichosis simplex (autosomal recessive hair loss) and woolly hair syndrome . Chicken models have shown that LPA6 mediates hair follicle maintenance via EGFR signaling and TGF-α pathways .

Cancer and Cell Migration

  • Hepatocellular Carcinoma: Overexpression of LPAR6 correlates with high proliferation rates and poor survival outcomes, suggesting a prognostic role .

  • Drug Resistance: Inhibition of LPAR6 (e.g., in DLD1 and HCT116 colon cancer cells) enhances motility and sensitivity to 5-fluorouracil .

Immune Modulation

LPAR6 suppresses T cell migration via Gα12/13-coupled pathways. In melanoma models, autotaxin (ATX)/LPA signaling inhibits CD8+ T cell infiltration, while LPAR6 antagonists (e.g., XAA) restore immune response .

Angiogenesis

Chicken LPAR6 mediates LPA-induced angiogenesis in the chorioallantoic membrane (CAM) assay, with effects comparable to VEGF . This highlights its role in vascular development and tumor-associated angiogenesis.

Disease Associations

DiseaseMechanismReferences
Hypotrichosis 8Loss-of-function mutations impair hair follicle maintenance
CancerOverexpression promotes proliferation; inhibition enhances drug sensitivity
Immune EvasionATX/LPA-LPAR6 axis suppresses T cell infiltration in tumors

Future Directions

  • Therapeutic Targeting: Development of LPAR6 antagonists (e.g., XAA) for cancer immunotherapy .

  • Hair Loss Therapies: Exploring LPAR6 agonists to restore hair growth in hypotrichosis .

  • Reproductive Biology: Investigating LPAR6’s role in early pregnancy, particularly in buffalo models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
LPAR6; P2RY5; Lysophosphatidic acid receptor 6; LPA receptor 6; LPA-6; Oleoyl-L-alpha-lysophosphatidic acid receptor; P2Y purinoceptor 5; P2Y5; Purinergic receptor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MVSSNCSTEDSFKYTLYGCVFSMVFVLGLIANCVAIYIFTFTLKVRNETTTYMLNLAISD LLFVFTLPFRIYYFVVRNWPFGDVLCKISVTLFYTNMYGSILFLTCISVDRFLAIVHPFR SKTLRTKRNARIVCVAVWITVLAGSTPASFFQSTNRQNNTEQRTCFENFPESTWKTYLSR IVIFIEIVGFFIPLILNVTCSTMVLRTLNKPLTLSRNKLSKKKVLKMIFVHLVIFCFCFV PYNITLILYSLMRTQTWINCSVVTAVRTMYPVTLCIAVSNCCFDPIVYYFTSDTNSELDK KQQVHQNT
Uniprot No.

Target Background

Function
This protein binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation.
Database Links

UniGene: Gga.48208

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Induced in activated T-cells.

Q&A

What is Lysophosphatidic Acid Receptor 6 (LPAR6) and what cellular signaling pathways does it activate?

LPAR6 is a G protein-coupled receptor that binds lysophosphatidic acid (LPA) and transduces cell signaling pathways. It belongs to the G protein-coupled receptor family and couples to multiple G proteins including G12/13, Gs, and Gi. LPAR6 was previously known as P2Y5 due to its sequence homology with P2Y receptors. Upon activation by LPA, LPAR6 stimulates multiple intracellular signaling pathways, including increased intracellular Ca²⁺ mobilization, cAMP accumulation, and ERK1/2 activation . These signaling cascades regulate various cellular processes, including proliferation, migration, and differentiation, which explains the diverse biological functions of LPAR6 across different tissues.

How is LPAR6 structurally characterized in avian species?

Chicken LPAR6 is a seven-transmembrane domain receptor protein similar to its mammalian counterparts. The recombinant partial chicken LPAR6 protein can be expressed in E. coli expression systems with high purity (>85% as determined by SDS-PAGE) . The chicken LPAR6 shares homology with human LPAR6 (UniProt ID: P43657 for human vs. P32250 for chicken), although complete structural studies comparing the avian and mammalian receptors remain limited. Researchers working with recombinant chicken LPAR6 should consider the protein's structural integrity, which can be assessed through techniques such as circular dichroism or functional binding assays to ensure the recombinant protein maintains native conformation.

What are the known biological functions of LPAR6 in avian species?

In avian species, LPAR6 plays important roles in various biological processes, including immune response during viral infections. Research has shown that purinergic receptors, a family to which LPAR6 is related through homology with P2Y receptors, exhibit differential expression during Marek's disease virus (MDV) infection in chickens . These expression patterns vary between MD-resistant white Leghorns and MD-susceptible Pure Columbian chickens, suggesting breed-specific responses. Additionally, the relationship between lysophosphatidic acid signaling and lipid metabolism indicates potential roles in adipogenesis and energy homeostasis in avian species . Understanding these functions is crucial for researchers designing experiments to investigate LPAR6's role in avian physiology and pathology.

What are the recommended methods for expressing and purifying recombinant chicken LPAR6?

For expression of recombinant chicken LPAR6, E. coli is a commonly used heterologous system that can produce the protein with purity levels exceeding 85% as determined by SDS-PAGE . The methodology typically involves:

  • Cloning the chicken LPAR6 gene (full-length or partial sequence) into an appropriate expression vector

  • Transforming E. coli cells with the recombinant plasmid

  • Inducing protein expression under optimized conditions

  • Cell lysis and extraction of the target protein

  • Purification using affinity chromatography (based on fusion tags)

  • Further purification steps as needed (ion exchange, size exclusion chromatography)

For researchers requiring high purity recombinant LPAR6, a purification strategy involving multiple chromatography steps is recommended. The presence of fusion tags should be considered based on downstream applications, as they may affect receptor functionality in certain assays.

What are the optimal storage conditions for maintaining recombinant LPAR6 stability?

Optimal storage conditions for recombinant chicken LPAR6 depend on the formulation:

  • For lyophilized protein: Storage at -20°C/-80°C provides stability for approximately 12 months

  • For liquid formulations: Storage at -20°C/-80°C with shelf life of approximately 6 months

For reconstitution, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. Addition of glycerol (final concentration 5-50%, with 50% being commonly used) is recommended for long-term storage . To maintain protein stability, researchers should avoid repeated freeze-thaw cycles, instead preparing small working aliquots that can be stored at 4°C for up to one week. Brief centrifugation of vials prior to opening is advised to ensure all protein content is collected at the bottom of the container.

What functional assays can verify the activity of recombinant chicken LPAR6?

To verify the functionality of recombinant chicken LPAR6, researchers can employ several assays:

Assay TypeMethodologyMeasured ParameterAdvantages
Ligand BindingCompetitive binding with labeled LPABinding affinity (Kd)Direct measure of receptor-ligand interaction
Calcium MobilizationFluorescent calcium indicatorsIntracellular Ca²⁺ elevationMeasures G-protein signaling
cAMP AccumulationELISA or FRET-based methodscAMP levelsAssesses Gs/Gi coupling
ERK1/2 PhosphorylationWestern blot or ELISAMAPK pathway activationDownstream signaling verification

When establishing these assays, researchers should include appropriate positive and negative controls. For instance, known LPAR6 agonists and antagonists should be tested alongside the recombinant protein to confirm specific activity. Cell lines expressing endogenous LPAR6 can serve as positive controls, while cells with LPAR6 knockdown can function as negative controls.

How is LPAR6 involved in cancer pathophysiology based on recent research?

LPAR6 demonstrates context-dependent roles in different cancer types. In breast cancer (BC), LPAR6 expression is significantly reduced compared to normal tissues (p < 0.001) and correlates with molecular classification of tumors (p < 0.05) . Higher LPAR6 expression is associated with better prognosis in breast cancer patients (p < 0.001), suggesting LPAR6 may function as a tumor suppressor in this context . Mechanistically, the CpG islands of LPAR6 are hypermethylated in breast cancer tissues compared to para-cancer tissues (p < 0.01), indicating epigenetic regulation of its expression .

Functional studies have shown that LPAR6 knockdown promotes cell migration and proliferation in breast cancer cell lines (p < 0.001) . Gene Set Enrichment Analysis (GSEA) confirmed that LPAR6 expression negatively correlates with cancer-promoting factors and positively correlates with tumor-suppressing factors . These findings contrast with observations in hepatocellular carcinoma, where LPAR6 overexpression correlates with higher proliferation rates and poorer survival outcomes . This demonstrates that LPAR6's role in cancer is tissue-specific and requires careful characterization in each tumor type.

What is the relationship between LPAR6 and viral infection responses in avian species?

Purinergic receptors, including those related to LPAR6 through sequence homology (LPAR6 was previously designated as P2Y5), show differential expression patterns during Marek's disease virus (MDV) infection in chickens . This herpesvirus causes a highly contagious cancer in chickens with significant economic impact on the poultry industry. Studies examining purinergic receptor responses during natural MDV infection have revealed tissue-specific expression patterns (P1A1, P2X1, and P2X6 in whole lung lavage cells) and breed-specific responses to infection .

Some purinergic receptors show MDV infection-responsive expression only in MD-susceptible Pure Columbian chickens (P1A2A, P2X1, P2X5, P2X7), while P2Y receptors demonstrate differential expression in both resistant and susceptible chicken lines during MDV infection and disease progression . This suggests that purinergic signaling, which shares pathways with LPAR6, may represent an important research area for understanding MDV replication and Marek's disease pathogenesis. Researchers investigating LPAR6 in avian species should consider these intersections between purinergic and lysophosphatidic acid signaling pathways.

How does LPAR6 interact with lipid metabolism pathways?

LPAR6 has important connections to lipid metabolism through its interaction with lysophosphatidic acid (LPA) and related pathways. Research indicates that LPA signaling interacts with the AGPAT2 pathway, which is involved in triglyceride synthesis . Excessive accumulation of lysophosphatidic acid can promote the proliferation of preadipocytes, while conversion of LPA by AGPAT2 reduces this effect .

In studies of chicken intramuscular preadipocyte cells (ICP2), it was demonstrated that regulation of AGPAT2 expression affected lipid metabolism. Specifically, up-regulation of AGPAT2 expression resulted in decreased accumulation of intracellular lysophosphatidic acid, leading to inhibited proliferation of preadipocytes . This connection between LPA signaling and adipogenesis pathways suggests that LPAR6 may indirectly influence lipid metabolism through its role in LPA signal transduction.

Additionally, LPA signaling connects to key adipogenic transcription factors like PPARγ, C/EBPα, and SREBP1 . For researchers studying LPAR6 in the context of metabolic processes, examining these pathway interactions can provide valuable insights into the receptor's broader physiological roles.

What statistical approaches are recommended for analyzing LPAR6 expression data?

When analyzing LPAR6 expression data, researchers should employ rigorous statistical methods appropriate for the experimental design. Based on published studies, the following approaches are recommended:

  • For comparing LPAR6 expression between tissues (e.g., cancer vs. normal):

    • Paired t-tests for matched sample comparisons, as used in studies of breast cancer tissues and matched para-cancer tissues

    • Mann-Whitney U test for non-parametric distributions

  • For correlating LPAR6 expression with clinical parameters:

    • Chi-square tests for categorical variables (e.g., molecular classification of tumors)

    • Kaplan-Meier analysis with log-rank tests for survival outcomes

  • For functional studies of LPAR6:

    • ANOVA with appropriate post-hoc tests for multi-group comparisons in overexpression or knockdown experiments

    • Multiple regression analyses to assess relationships between LPAR6 and downstream markers

  • For broader pathway analysis:

    • Gene Set Enrichment Analysis (GSEA) to identify pathways correlated with LPAR6 expression

    • Hierarchical clustering to identify expression patterns across multiple genes

Sample size determination should be performed a priori, with power analyses based on expected effect sizes. For gene expression studies, normalization to appropriate housekeeping genes is essential, with validation using multiple reference genes recommended for RT-qPCR experiments.

How can researchers address contradictory findings regarding LPAR6's role in different cellular contexts?

Contradictory findings regarding LPAR6 function across different tissues and cellular contexts present significant challenges. To address these contradictions methodologically:

  • Perform comprehensive literature review to identify tissue-specific patterns:

    • LPAR6 acts as a tumor suppressor in breast cancer

    • LPAR6 correlates with poorer outcomes in hepatocellular carcinoma

    • LPAR6 has distinct roles in other contexts like hair follicle development

  • Design experiments with appropriate controls:

    • Include multiple cell lines representing different tissues

    • Perform gain-of-function and loss-of-function experiments in parallel

    • Validate findings using both in vitro and in vivo models when possible

  • Characterize signaling pathway variations:

    • Assess G-protein coupling preferences in different cell types

    • Measure activation of multiple downstream pathways (Ca²⁺, cAMP, ERK1/2)

    • Identify cell-specific interaction partners through co-immunoprecipitation or proximity labeling

  • Consider epigenetic regulation:

    • Analyze LPAR6 promoter methylation across tissues

    • Examine histone modifications and chromatin accessibility

    • Test epigenetic modulators like 5-aza-2'-deoxycytidine (5-Aza)

By systematically addressing these aspects, researchers can develop more nuanced models of LPAR6 function that account for its context-dependent roles.

What are the challenges in interpreting cross-species differences in LPAR6 function?

Interpreting cross-species differences in LPAR6 function presents several methodological challenges:

  • Sequence and structural variations:

    • Differences in amino acid sequence between human (P43657) and chicken (P32250) LPAR6

    • Potential variations in post-translational modifications

    • Differences in transmembrane domain structure affecting ligand binding

  • Expression pattern differences:

    • Species-specific tissue distribution patterns

    • Developmental timing of expression

    • Breed-specific variations in avian models

  • Experimental system limitations:

    • Availability of species-specific antibodies and detection reagents

    • Differences in cell culture systems between mammalian and avian models

    • Limited availability of genetically modified avian models

  • Signaling pathway conservation:

    • Variations in G-protein coupling efficiency

    • Differences in downstream effector expression

    • Species-specific interaction partners

To address these challenges, researchers should employ comparative genomics approaches, develop species-specific reagents, and perform careful validation across models. When extrapolating between species, findings should be interpreted cautiously with explicit acknowledgment of potential differences.

What are emerging research areas for LPAR6 in avian immunology?

Several promising research directions for LPAR6 in avian immunology deserve further investigation:

  • Role in viral infection responses:

    • Building on purinergic receptor studies in Marek's disease , investigate LPAR6 expression changes during MDV infection

    • Determine if LPAR6 signaling influences viral replication or latency

    • Explore potential interactions between LPAR6 and avian immune cell function

  • Breed-specific variations:

    • Compare LPAR6 expression and function between different chicken breeds with varying disease susceptibility

    • Identify genetic polymorphisms in LPAR6 that correlate with immune function

    • Develop breed-specific targeted approaches based on LPAR6 pathway variations

  • Therapeutic targeting:

    • Develop LPAR6 modulators as potential antivirals or immune adjuvants

    • Evaluate LPAR6 as a biomarker for disease susceptibility

    • Investigate combined targeting of LPAR6 and purinergic receptors

These directions could significantly advance our understanding of avian immunology and potentially lead to novel interventions for economically important avian diseases.

How might epigenetic regulation of LPAR6 be leveraged in research applications?

The epigenetic regulation of LPAR6 presents several intriguing research opportunities:

  • Methylation status as biomarker:

    • Building on findings that LPAR6 CpG islands are hypermethylated in breast cancer

    • Develop methylation assays for diagnostic or prognostic applications

    • Correlate methylation patterns with disease states in various contexts

  • Epigenetic modulation approaches:

    • Expand on studies showing 5-Aza treatment upregulates LPAR6 expression

    • Explore combined epigenetic modulation strategies

    • Investigate tissue-specific epigenetic regulation mechanisms

  • Developmental epigenetics:

    • Characterize LPAR6 methylation changes during embryonic development

    • Examine environmental influences on LPAR6 epigenetic status

    • Compare epigenetic regulation across species and breeds

These approaches could reveal fundamental mechanisms controlling LPAR6 expression and potentially lead to novel therapeutic strategies targeting its epigenetic regulation.

What technological advancements could enhance LPAR6 research in avian species?

Several technological advancements could significantly advance LPAR6 research in avian species:

  • Improved recombinant protein production:

    • Development of avian-specific expression systems for full-length LPAR6

    • Enhanced purification methods preserving native conformation

    • Advanced stabilization techniques for membrane proteins

  • Gene editing technologies:

    • Application of CRISPR/Cas9 to develop LPAR6 knockout or knock-in avian models

    • Development of conditional expression systems for tissue-specific studies

    • Creation of reporter lines for real-time monitoring of LPAR6 expression

  • Advanced imaging and detection:

    • Development of avian-specific LPAR6 antibodies and probes

    • Application of super-resolution microscopy for receptor localization

    • In vivo imaging techniques for tracking LPAR6 expression in living animals

  • Multi-omics integration:

    • Combined analysis of transcriptomics, proteomics, and metabolomics data

    • Systems biology approaches to understand LPAR6 in broader signaling networks

    • Development of computational models predicting LPAR6 function across tissues

These technological advances would address current limitations in studying avian LPAR6 and potentially accelerate discovery in this field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.