Recombinant Chicken Lysosomal-associated transmembrane protein 4A (LAPTM4A)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant chicken LAPTM4A is produced using bacterial expression systems. Key steps include:

  1. Cloning: The gene is inserted into a plasmid with a His-tag for affinity purification.

  2. Expression: Induced in E. coli under optimized conditions (e.g., temperature, IPTG concentration).

  3. Purification: Nickel affinity chromatography followed by gel filtration or ion-exchange chromatography .

Applications in Research:

  • Membrane trafficking studies: To investigate sorting mechanisms (e.g., Nedd4-mediated lysosomal targeting) .

  • Toxin resistance models: LAPTM4A depletion in human cells confers resistance to Shiga toxins by disrupting Gb3 synthesis .

Role in Nucleoside Transport

LAPTM4A is hypothesized to transport nucleosides across lysosomal membranes, though its exact substrate specificity remains unclear .

Interaction with Nedd4

Human LAPTM4A binds Nedd4 via PY motifs, which are critical for lysosomal sorting. Mutations in these motifs lead to mislocalization to the plasma membrane .

Gb3 Synthesis and Toxin Resistance

LAPTM4A interacts with A4GALT (a galactosyltransferase) to regulate globotriaosylceramide (Gb3) synthesis. Gb3 is a receptor for Shiga toxins; LAPTM4A depletion reduces Gb3 levels, conferring toxin resistance .

Comparative Analysis with Human LAPTM4A

FeatureHuman LAPTM4AChicken LAPTM4A (Inferred)
Expression SystemE. coli, insect cells E. coli (recombinant production)
TagGST, His, rho-1D4 His-tag
Primary FunctionLysosomal transport, Gb3 regulation Likely analogous to human homolog
Key InteractionsNedd4, A4GALT Predicted Nedd4/A4GALT interactions

Lysosomal Sorting Mechanisms

  • Nedd4 dependency: Human LAPTM4A requires Nedd4 for lysosomal localization. In Nedd4-deficient cells, it accumulates at the plasma membrane .

  • PY motif specificity: Mutations in LAPTM4A’s PY motifs (e.g., P213A/P228A) abolish Nedd4 binding, highlighting their functional importance .

Toxin Pathways

  • Shiga toxin resistance: LAPTM4A knockout in human cells reduces Gb3 synthesis, preventing Shiga toxin binding .

  • Cross-species relevance: Chicken LAPTM4A may serve as a model for studying toxin resistance mechanisms in avian systems.

Applications in Biomedical Research

  • Protein-protein interaction studies: Investigating LAPTM4A’s role in membrane trafficking and glycolipid metabolism.

  • Therapeutic target development: For diseases involving lysosomal dysfunction or toxin susceptibility.

  • Transgenic animal models: Potential use in avian systems to produce recombinant proteins (e.g., egg-white bioreactors) .

Limitations and Future Directions

  • Structural studies: Limited crystallographic data for LAPTM4A; chicken homologs could aid in structural elucidation.

  • Functional validation: Direct studies on chicken LAPTM4A are needed to confirm conserved roles.

  • Bioreactor potential: Exploring chicken LAPTM4A in transgenic egg-white production systems for therapeutic proteins .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
LAPTM4A; RCJMB04_1k20; Lysosomal-associated transmembrane protein 4A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
LAPTM4A
Target Protein Sequence
MTFKRSRDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMGILLTVEVTHPNVVPTVNIQY EVIGNYYASERMAENACVLFAISLLMFTISAMMVYGAIAHRVGWLIPFFCYQLFDFVVSC LVAISSLTYLPRIKDYLDQLPDFPYKDDLLSLDSSCLLFIVLVFFALFIILKAYLINCVW NCYKYISNRNLPEIAVYPAFEAPPQYVLPTYEMAVKMPEKEPSPSYIPA
Uniprot No.

Target Background

Function
May be involved in the intracellular transport of nucleosides and/or nucleoside derivatives between the cytosol and the lumen of a membrane-bound compartment.
Database Links
Protein Families
LAPTM4/LAPTM5 transporter family
Subcellular Location
Endomembrane system; Multi-pass membrane protein.

Q&A

What is the basic structural organization of LAPTM4A?

LAPTM4A is a four transmembrane-spanning protein that is primarily localized in endosomes and lysosomes. The protein contains several putative lysosomal targeting signals at its C-terminal cytoplasmic domain, including tyrosine-based motifs (YxxΦ) and PY motifs (L/PxxY) . These structural elements are critical for its proper subcellular localization and function within the endosomal-lysosomal system.

How is LAPTM4A trafficked within cells?

LAPTM4A trafficking follows a complex pathway involving several molecular mechanisms. The protein is transported from the Golgi apparatus to late endosomes/lysosomes through a process that requires binding to the E3 ubiquitin ligase Nedd4-1. While LAPTM4A can be ubiquitinated independently of its PY motifs and Nedd4-1, the interaction between LAPTM4A and Nedd4-1 (via PY motifs) is necessary for effective sorting from the Golgi to late endosomes/lysosomes . Interestingly, LAPTM4A is localized in the lumen of late endosomes rather than in the limiting membrane, and is gradually degraded in lysosomes over time .

What role does the ESCRT machinery play in LAPTM4A trafficking?

Advanced research has revealed that the endosomal sorting complexes required for transport (ESCRT) components are essential for LAPTM4A trafficking. siRNA knockdown of ESCRT components, which typically mediate the sorting of ubiquitinated membrane proteins into intralumenal vesicles (ILVs) of endosomes, selectively blocks the transport of LAPTM4A to endosomes . This suggests that LAPTM4A utilizes the ESCRT machinery for its proper localization, similar to other ubiquitinated membrane proteins destined for lysosomal degradation.

How is LAPTM4A expression altered in glioma, and what are the clinical implications?

Recent studies have demonstrated that LAPTM4A is significantly upregulated in gliomas compared to normal brain tissue . This upregulation is associated with clinicopathological features and poor prognosis in glioma patients . The correlation between elevated LAPTM4A expression and negative clinical outcomes suggests that LAPTM4A may serve as a prognostic biomarker in glioma. Researchers investigating LAPTM4A expression in tumor samples should consider employing RNA-seq data analysis from patient cohorts, comparing expression levels across tumor grades and correlating with survival data to establish prognostic value.

Through which molecular mechanisms does LAPTM4A contribute to cancer progression?

LAPTM4A contributes to cancer progression through multiple mechanisms. Functional enrichment analysis has shown that LAPTM4A plays roles in immune system regulation and cancer progression pathways . In vitro experiments have indicated that LAPTM4A may influence metastasis through the epithelial-mesenchymal transition (EMT) pathway in glioma . Additionally, LAPTM4A expression shows positive associations with cellular responses to hypoxia, apoptosis, inflammatory response, angiogenesis, and EMT . These findings suggest that LAPTM4A may serve as a key modulator of multiple cancer hallmarks, making it a potentially valuable therapeutic target.

What is the relationship between LAPTM4A expression and drug sensitivity in cancer?

Drug sensitivity analysis has revealed that patients with high LAPTM4A expression demonstrate differential responses to various therapeutic agents. Notably, patients with elevated LAPTM4A expression are more sensitive to doxorubicin, which interestingly contributes to a reduction in LAPTM4A expression . Analysis using the CGP2016 database has shown that specific medications can downregulate LAPTM4A expression, potentially enhancing therapeutic efficacy . Conversely, high LAPTM4A expression has been associated with resistance to 41 small-molecule drugs . These findings provide important insights for personalized medicine approaches in glioma treatment.

How does LAPTM4A influence immune cell infiltration in the tumor microenvironment?

LAPTM4A expression significantly correlates with immune cell infiltration in the tumor microenvironment. Analysis using the TIMER method has demonstrated a strong association between LAPTM4A expression and the infiltration of neutrophils, macrophages, and dendritic cells in glioma, with milder correlations with B cells, CD4+ T cells, and CD8+ T cells . Further investigation using TIMER2 has revealed positive correlations between LAPTM4A expression and infiltration levels of common lymphoid progenitors, cancer-associated fibroblasts, macrophages, monocytes, and neutrophils in lower-grade glioma (LGG) . These findings suggest that LAPTM4A may play a crucial role in modulating the immune landscape within tumors.

What is the relationship between LAPTM4A and immune checkpoint molecules?

Research has established a significant association between LAPTM4A expression and multiple immune checkpoint (ICP) genes. High LAPTM4A expression correlates with upregulation of various ICP genes, with particularly strong correlations observed with PDCD1LG2, CD274 (PD-L1), and HAVCR2 . These relationships suggest that LAPTM4A may contribute to immunosuppression within the tumor microenvironment, potentially influencing the efficacy of immunotherapeutic approaches. Researchers investigating these associations should consider co-expression analyses and functional studies to determine the mechanistic relationships between LAPTM4A and immune checkpoint regulation.

How might LAPTM4A expression influence responses to immunotherapy?

Analysis of TIDE (Tumor Immune Dysfunction and Exclusion) scores indicates that patients with high LAPTM4A expression tend to have elevated TIDE scores, suggesting a reduced response to immune checkpoint blockade (ICB) therapy and potentially shorter survival following such treatment . This finding positions LAPTM4A as a potential predictive biomarker for immunotherapy response, with downregulation of LAPTM4A potentially enhancing immunotherapeutic efficacy in glioma patients . Investigators could explore therapeutic strategies that target LAPTM4A in combination with immunotherapy to potentially improve treatment outcomes.

What methods are effective for studying LAPTM4A localization and trafficking in cells?

To investigate LAPTM4A localization and trafficking, researchers can employ multiple complementary approaches:

  • Fluorescence microscopy with GFP-tagged LAPTM4A constructs to visualize trafficking in real-time

  • Co-localization studies with markers for different cellular compartments (Golgi, early endosomes, late endosomes, lysosomes)

  • siRNA knockdown of trafficking components (like ESCRT machinery) to assess effects on LAPTM4A localization

  • Immunoprecipitation experiments to identify binding partners involved in trafficking

  • Pulse-chase experiments to track the kinetics of LAPTM4A movement through cellular compartments

These approaches can be combined with site-directed mutagenesis of key motifs (such as the PY motifs) to elucidate their functional relevance in LAPTM4A trafficking.

How can researchers effectively study LAPTM4A's role in immune cell function?

For investigating LAPTM4A's functions in immune cells, researchers should consider:

  • Flow cytometry analysis to quantify LAPTM4A expression in different immune cell populations

  • RNA-seq and proteomics comparisons of immune cells with normal versus altered LAPTM4A expression

  • Co-culture systems of tumor cells and immune cells with LAPTM4A manipulation

  • In vitro functional assays measuring immune cell activation, cytokine production, and cytotoxicity against target cells

  • ChIP-seq analysis to identify transcriptional regulators of LAPTM4A in immune cells

These methodologies can elucidate how LAPTM4A influences immune cell function, particularly in the context of antigen presentation and immune response regulation.

What bioinformatic approaches are most valuable for analyzing LAPTM4A in large-scale genomic and transcriptomic datasets?

Advanced bioinformatic analysis of LAPTM4A should include:

  • Differential expression analysis across cancer types and normal tissues using TCGA and GTEx datasets

  • Weighted gene co-expression network analysis (WGCNA) to identify genes functionally associated with LAPTM4A

  • Survival analysis using Kaplan-Meier plots and Cox regression models to assess prognostic value

  • Gene set enrichment analysis (GSEA) to identify biological pathways associated with LAPTM4A expression

  • Construction and analysis of competing endogenous RNA (ceRNA) networks involving LAPTM4A

  • Integration of multi-omics data (genomic, transcriptomic, proteomic) to develop comprehensive models of LAPTM4A function

These approaches have successfully identified the FGD5-AS1-hsa-miR-103a-3p-LAPTM4A axis as a potential facilitator of glioma progression .

How does chicken LAPTM4A differ from mammalian orthologs in structure and function?

While the search results don't provide specific comparisons between chicken and mammalian LAPTM4A, researchers should consider comparative genomic approaches to identify conserved and divergent features. Analysis should include sequence alignment, structural prediction, and functional domain conservation assessment. Previous research with chicken dendritic cell-lysosomal associated membrane protein (DC-LAMP) has shown that unlike mammalian DC-LAMP, chicken DC-LAMP mRNA may also be expressed in chicken B cells and macrophages , suggesting potential species-specific differences in lysosomal protein expression patterns.

What are the optimal conditions for producing recombinant chicken LAPTM4A for experimental use?

For researchers producing recombinant chicken LAPTM4A, optimization of expression systems is critical. While specific details for LAPTM4A are not provided in the search results, analogous approaches used for other chicken proteins can be adapted. For example, researchers have successfully cultured chicken bone marrow-derived dendritic cells using recombinant chicken GM-CSF and IL-4 produced from transfected COS-7 cells . For recombinant protein production, considerations should include codon optimization for the expression system, appropriate tag selection for purification, and validation of proper folding and post-translational modifications.

How might LAPTM4A be involved in the ceRNA network regulation in different cancers?

Research has identified the FGD5-AS1-hsa-miR-103a-3p-LAPTM4A axis as a facilitator of glioma progression , suggesting important roles for LAPTM4A in competing endogenous RNA networks. Future studies should explore:

  • Comprehensive identification of miRNAs that target LAPTM4A across cancer types

  • Functional validation of proposed ceRNA interactions using reporter assays

  • Investigation of how ceRNA network perturbations affect LAPTM4A expression and cancer progression

  • Exploration of potential therapeutic approaches targeting the ceRNA network to modulate LAPTM4A expression

This research direction represents an emerging frontier in understanding post-transcriptional regulation of LAPTM4A in cancer biology.

What is the potential for developing LAPTM4A-targeted therapeutics for cancer treatment?

Given LAPTM4A's association with poor prognosis in glioma and its multiple roles in cancer biology, exploring LAPTM4A-targeted therapies presents an intriguing research direction. Investigators should consider:

  • Development of small molecule inhibitors that disrupt LAPTM4A trafficking or function

  • Gene therapy approaches to downregulate LAPTM4A expression

  • Combination therapies leveraging the finding that doxorubicin sensitivity correlates with high LAPTM4A expression

  • Immunotherapeutic strategies that account for LAPTM4A's influence on the tumor immune microenvironment

  • Screening for compounds that modify LAPTM4A expression or function using high-throughput approaches

These therapeutic development efforts should be informed by deeper understanding of LAPTM4A's fundamental biology and its context-specific roles in different cancer types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.