Recombinant Chicken Magnesium transporter protein 1 (MAGT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MAGT1; RCJMB04_22a7; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-328
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
MAGT1
Target Protein Sequence
QKRKEMVLSEKVSQLMEWTSKRSVIRMNGDKFRRLVKAPPRNYSVIVMFTALQPHRQCVV CKQADEEYQVLANSWRYSSAFTNKIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPK RGDTYELQVRGFAAEQLARWVADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRGSN LDFLYNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGQVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLHEAATSDMDVGKRKIMCIAGIGLVVFFFSWLLSVFRSKYHGYP YSFLMS
Uniprot No.

Target Background

Function
This protein serves as an accessory component of the N-oligosaccharyl transferase (OST) complex. The complex catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. It plays a role in N-glycosylation of STT3B-dependent substrates, particularly facilitating the glycosylation of acceptor sites positioned near cysteine residues. In its oxidized form, it is believed to form transient mixed disulfides with a glycoprotein substrate, enhancing STT3B's access to the unmodified acceptor site. Beyond its oxidoreductase-dependent functions, this protein also contributes to the STT3B-containing OST complex through oxidoreductase-independent mechanisms, potentially involving substrate recognition. Additionally, it may participate in Mg(2+) transport in epithelial cells.
Database Links
Protein Families
OST3/OST6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is chicken MAGT1 and how does it compare to human MAGT1?

Chicken Magnesium Transporter Protein 1 (MAGT1) is a selective plasma membrane Mg2+ transporter essential for vertebrate magnesium influx. The chicken MagT1 coding sequence was identified from DT40 B cell cDNA using primers designed from the published gallus gallus MagT1 sequence (GenBank ID: NM_001006435). While both chicken and human MAGT1 function as magnesium transporters, they differ in specific amino acid sequences but maintain conserved functional domains. Both are evolutionarily conserved and play critical roles in cellular magnesium homeostasis, making chicken MAGT1 a valuable model for comparative studies of magnesium transport mechanisms across vertebrate species .

What is the importance of MAGT1 in cellular magnesium homeostasis?

MAGT1 serves as a critical magnesium transporter that contributes to maintaining proper intracellular Mg2+ levels. Research demonstrates that MAGT1 is essential for vertebrate Mg2+ influx and is broadly expressed across tissues. Its function becomes particularly important under conditions of magnesium deficiency, where studies show transcriptional upregulation of MAGT1 in response to hypomagnesic conditions. In TRPM7-deficient cells (another important magnesium regulator), MAGT1 expression increases as a compensatory mechanism, indicating its crucial role in maintaining magnesium homeostasis when primary transport mechanisms are compromised . Furthermore, MAGT1 deficiency has significant immunological consequences, as evidenced by its role in X-linked immunodeficiency with magnesium defect, Epstein-Barr virus infection, and neoplasia (XMEN), highlighting the critical role of magnesium regulation in immune function .

How is recombinant chicken MAGT1 typically cloned and expressed for research purposes?

The cloning of recombinant chicken MAGT1 typically follows a systematic protocol as demonstrated in published research:

  • RNA Extraction and cDNA Synthesis: Total RNA is isolated from chicken cells (typically DT40 B cells) using RNeasy or similar kits and converted to cDNA using reverse transcriptase (e.g., Superscript III RT).

  • PCR Amplification: The coding sequence is amplified using primers designed from the published gallus gallus MAGT1 sequence. For example, researchers have successfully used primers: 5'-ACGTGGTACCACTCATTAGGAAACTGTATGGATATCC-3' and 5'-ACGTAAGCTTATGGCGGCGCTGCCGGTACTTGTG-3' .

  • Vector Cloning: The amplified MAGT1 sequence is cloned into an appropriate expression vector, such as pcDNA4/TO with tags for detection (e.g., C-terminal FLAG tag), using restriction enzymes like KpnI and HindIII .

  • Transfection and Selection: The construct is transfected into appropriate cell lines (such as TRPM7−/− DT40 cells) using standard transfection methods, followed by selection with appropriate antibiotics (e.g., Zeocin at 1mg/ml) to establish stable expressing cell lines .

  • Expression Verification: Expression is verified through immunoblotting, typically using antibodies against the added tag (e.g., anti-FLAG) .

This methodological approach ensures the successful production of functional recombinant chicken MAGT1 for subsequent experimental investigations.

What are the recommended methods for measuring MAGT1-mediated magnesium transport in experimental systems?

For measuring MAGT1-mediated magnesium transport, researchers typically employ fluorescent indicators that specifically detect changes in intracellular free Mg2+ levels. The following methodology is recommended based on established research protocols:

  • Cell Preparation: Culture cells expressing recombinant chicken MAGT1 under controlled magnesium conditions. For comparative studies, prepare control cells and MAGT1-expressing cells under identical conditions.

  • Magnesium Depletion: Preincubate cells in low-magnesium media (e.g., 0.5 mM MgCl₂) for 14-18 hours to create magnesium-depleted conditions.

  • Fluorescent Loading: Load cells with a Mg2+-sensitive fluorescent dye such as Mag-fura, which allows for ratiometric measurement of intracellular free Mg2+ levels.

  • Magnesium Add-back Experiment: Monitor fluorescence before and after the addition of varying concentrations of MgCl₂ (e.g., 9.5 mM or 19.5 mM) to the extracellular medium .

  • Ratiometric Analysis: Calculate the fluorescence ratio changes over time, which reflect the rate and capacity of Mg2+ uptake.

  • Comparative Assessment: Compare Mg2+ uptake rates between MAGT1-expressing cells and control cells to determine the specific contribution of MAGT1 to magnesium transport .

This approach allows for quantitative assessment of MAGT1-mediated magnesium transport and enables comparison of transport efficiency between different experimental conditions or MAGT1 variants.

How does recombinant chicken MAGT1 compensate for TRPM7 deficiency in research models?

Recombinant chicken MAGT1 provides partial compensation for TRPM7 deficiency through several mechanisms:

This compensatory relationship makes TRPM7−/− cells an excellent model system for testing the functionality of various magnesium transport pathways, including recombinant chicken MAGT1.

What experimental controls should be used when studying MAGT1 overexpression in TRPM7-deficient systems?

  • Wild-type Cells: Include wild-type cells (e.g., DT40 WT) expressing endogenous levels of both TRPM7 and MAGT1 as positive controls for normal magnesium homeostasis and cell growth .

  • TRPM7-deficient Cells: Use non-complemented TRPM7−/− cells as negative controls to establish baseline defects in magnesium uptake and cell growth .

  • TRPM7-rescued Cells: Include TRPM7−/− cells with reintroduced TRPM7 expression as controls to differentiate between TRPM7-specific effects and general magnesium transport effects .

  • Empty Vector Controls: TRPM7−/− cells transfected with the empty expression vector (without MAGT1) should be included to control for any effects of the transfection process or vector components.

  • Varying Magnesium Conditions: Perform experiments under different extracellular magnesium concentrations (e.g., 0.5 mM, 10 mM, and 20 mM MgCl₂) to assess magnesium-dependent effects .

  • Time-course Experiments: Monitor growth curves and magnesium uptake over extended periods (e.g., 6 days for growth assays) to capture the full dynamics of MAGT1-mediated compensation .

  • Expression Level Verification: Confirm comparable expression levels of recombinant MAGT1 across different experimental samples using immunoblotting with anti-tag antibodies (e.g., anti-FLAG) .

These controls collectively establish the specificity and extent of MAGT1's ability to compensate for TRPM7 deficiency while controlling for confounding variables.

How is MAGT1 gene expression regulated under different magnesium conditions?

MAGT1 gene expression demonstrates dynamic regulation in response to changing magnesium conditions, with tissue-specific variations:

  • Upregulation in Hypomagnesic Conditions: In many cell types, including DT40 B cells, MAGT1 expression increases significantly under low magnesium conditions. Quantitative RT-PCR analysis shows elevated MAGT1-specific transcript levels when cells are cultured in magnesium-free medium for 24 hours (p<0.05 compared to normal magnesium conditions) .

  • Enhanced Expression in TRPM7-deficient Cells: TRPM7−/− cells show higher baseline MAGT1 expression compared to wild-type cells, even under high magnesium conditions (10 mM MgCl₂). This upregulation becomes even more pronounced when these deficient cells are deprived of magnesium (p<0.01 and p<0.001 respectively, compared to wild-type cells under the same conditions) .

  • TRPM7-independent Regulation: Importantly, the hypomagnesic induction of MAGT1 expression occurs even in the absence of TRPM7, indicating that this regulatory mechanism does not require TRPM7's sensing or signaling functions .

  • Tissue-specific Regulation Patterns: Unlike the consistent upregulation observed in DT40 cells, MAGT1 expression remains unchanged in mammary epithelial cells under low magnesium conditions, while rumen epithelial cells actually downregulate MAGT1 expression in response to low magnesium, suggesting tissue-specific regulatory mechanisms .

These findings indicate a complex, context-dependent regulation of MAGT1 expression that likely serves to maintain magnesium homeostasis under varying environmental conditions.

What methods are recommended for quantifying MAGT1 gene expression in different experimental conditions?

For accurate quantification of MAGT1 gene expression across experimental conditions, the following methodological approach is recommended:

  • RNA Isolation: Extract total RNA from experimental samples using validated methods such as RNeasy (Qiagen) or similar RNA isolation kits to ensure high-quality RNA preparations .

  • Reverse Transcription: Convert isolated RNA to cDNA using a reliable reverse transcriptase system such as Superscript III RT (Invitrogen) following manufacturer's protocols .

  • Quantitative RT-PCR Design:

    • Select appropriate primers targeting the MAGT1 gene. For chicken MAGT1, validated primers include: Forward 5'-GTGAACTATATCCATGGAAGC-3' and Reverse 5'-TCCTAAAGTAACACCACCATTG-3' .

    • Include appropriate housekeeping genes as internal controls for normalization, such as GAPDH (Forward 5'-TTGTTTCCTGGTATGACAATGAGTTT-3', Reverse 5'-CTCACTCCTTGGATGCCATGT-3') .

  • qPCR Methodology: Perform quantitative PCR using validated reagents such as Sybr-Green Master Mix on a reliable thermal cycler with real-time detection capabilities (e.g., DNA Engine Opticon 2) .

  • Experimental Design Considerations:

    • Include appropriate time points to capture dynamic changes in expression (e.g., 0, 4, and 24 hours after magnesium depletion) .

    • Test multiple magnesium concentrations to establish dose-dependent responses.

    • Include biological replicates (minimum n=3) for statistical validity.

  • Data Analysis:

    • Normalize MAGT1 expression to housekeeping gene expression using established calculations (e.g., ΔΔCt method).

    • Apply appropriate statistical tests to determine significance of expression changes across conditions.

This methodological approach ensures reliable and reproducible quantification of MAGT1 gene expression changes in response to experimental manipulations.

How does MAGT1 function differ in immune cells compared to other cell types?

MAGT1 demonstrates distinctive functions in immune cells compared to other tissues:

  • Glycosylation-dependent Processes: In immune cells, MAGT1 serves not only as a magnesium transporter but also plays a crucial role as an accessory protein for STT3B, a catalytic subunit of the oligosaccharyltransferase protein complex involved in N-glycosylation. Immune cells rely exclusively on MAGT1 to facilitate asparagine (N)-linked glycosylation of specific STT3B-dependent glycoproteins, unlike other tissues that may have alternative pathways .

  • NKG2D Expression Regulation: MAGT1 deficiency in immune cells leads to chronic reductions in basal free Mg2+ levels, which contributes to the loss of NKG2D expression on natural killer (NK) cells and CD8+ cytotoxic T cells. This relationship is critical for antiviral and antitumor immune responses and appears to be particularly important in immune cell function .

  • Immunological Consequences: The immunological manifestations of MAGT1 deficiency (as seen in XMEN disease) are more pronounced than effects in other tissues, suggesting a heightened dependence of immune cells on MAGT1 function. These include susceptibility to viral infections (particularly EBV) and increased risk of lymphoma .

  • Compensatory Mechanisms: While some tissues may have redundant magnesium transport systems that can compensate for MAGT1 deficiency, immune cells appear to be more vulnerable to its loss, suggesting fewer alternative pathways in these specialized cells .

These differences highlight the specialized role of MAGT1 in immune cell function beyond its general role in magnesium homeostasis, explaining why immunological abnormalities predominate in MAGT1-deficient conditions like XMEN disease.

What experimental approaches can detect MAGT1-associated immune defects in research models?

To detect MAGT1-associated immune defects in research models, several experimental approaches can be employed:

  • Flow Cytometric Analysis of NKG2D Expression:

    • Measure NKG2D expression on NK cells and CD8+ T cells by flow cytometry

    • Reduced or absent NKG2D expression is a hallmark of MAGT1 deficiency in immune cells

    • Compare expression levels between MAGT1-deficient models and controls under various magnesium conditions

  • Intracellular Free Magnesium Measurement:

    • Use magnesium-sensitive fluorescent dyes like Mag-fura to quantify intracellular free Mg2+ levels

    • Monitor baseline levels and recovery patterns after magnesium supplementation

    • Correlate magnesium levels with immune cell function parameters

  • Viral Challenge Assays:

    • Assess susceptibility to viral infection, particularly EBV, in MAGT1-deficient models

    • Measure viral load by quantitative PCR or assess viral proteins by immunological methods

    • Compare viral clearance capabilities between normal and MAGT1-deficient immune cells

  • N-Glycosylation Assessment:

    • Analyze glycosylation status of key immune receptors using lectins or glycosylation-specific antibodies

    • Employ mass spectrometry to identify alterations in glycan structures

    • Compare glycosylation patterns of STT3B-dependent proteins in normal versus MAGT1-deficient models

  • Immune Cell Functional Assays:

    • Assess NK cell cytotoxicity against target cells

    • Measure T cell proliferation in response to stimuli

    • Evaluate cytokine production profiles

    • Test antigen presentation capabilities

  • Genetic Complementation Studies:

    • Reintroduce wild-type or mutant MAGT1 constructs into deficient models

    • Assess restoration of immune functions with different MAGT1 variants

    • Correlate functional recovery with magnesium transport capability

These approaches collectively provide a comprehensive assessment of MAGT1's role in immune function and can identify specific mechanisms by which MAGT1 deficiency leads to immune dysregulation.

What structural features of recombinant chicken MAGT1 are critical for its magnesium transport function?

While specific structural details of chicken MAGT1 are still being elucidated, several critical features can be inferred from current research and comparison with mammalian MAGT1:

  • Transmembrane Domains: MAGT1 contains multiple transmembrane domains that form a channel or pore structure through which magnesium ions are transported across the plasma membrane. These domains are highly conserved across species and are essential for transport function .

  • Magnesium Binding Sites: Specific amino acid residues within the protein structure provide coordination sites for Mg2+ ions. These residues likely include negatively charged amino acids (aspartate, glutamate) that interact with the positively charged magnesium ions.

  • C-terminal Region: The C-terminal portion of MAGT1 appears functionally important, as evidenced by studies where a C-terminal FLAG tag was successfully used without disrupting function. This suggests this region may be involved in regulatory interactions rather than direct transport functionality .

  • N-Glycosylation Sites: As MAGT1 also functions in the N-glycosylation process, it contains structural features that facilitate interaction with the oligosaccharyltransferase complex, particularly with STT3B .

  • Conservation Patterns: Evolutionary conservation analysis reveals regions of highest conservation across species, which likely correspond to functionally critical domains. The chicken MAGT1 sequence (GenBank ID: NM_001006435) shares significant homology with mammalian MAGT1 proteins in these essential regions .

Mutations that disrupt these structural features can impair magnesium transport function, as demonstrated in clinical cases where MAGT1 mutations (such as the c.916del mutation) lead to functional deficiency syndromes like XMEN disease .

How can site-directed mutagenesis be used to investigate critical residues in recombinant chicken MAGT1?

Site-directed mutagenesis offers a powerful approach to identify and characterize critical residues in recombinant chicken MAGT1:

  • Target Residue Selection Strategy:

    • Focus on evolutionarily conserved amino acids across species

    • Prioritize charged residues (Asp, Glu) in predicted transmembrane domains that may coordinate Mg2+ ions

    • Target residues analogous to those implicated in human MAGT1 mutations (e.g., equivalent to the c.916del mutation region)

    • Consider residues at predicted protein-protein interaction interfaces, particularly those potentially involved in STT3B interaction

  • Mutagenesis Protocol:

    • Design mutagenic primers to introduce specific amino acid substitutions

    • Use PCR-based site-directed mutagenesis techniques (e.g., QuikChange)

    • Create a panel of mutants including:

      • Conservative substitutions (maintaining charge/size properties)

      • Non-conservative substitutions (altering charge/size properties)

      • Alanine-scanning mutations

      • Truncation mutations to identify essential domains

  • Functional Assessment:

    • Express mutant constructs in TRPM7−/− DT40 cells using established transfection protocols

    • Verify protein expression by immunoblotting using C-terminal tags

    • Assess magnesium transport function using Mag-fura fluorescence assays

    • Evaluate growth complementation capacity in low-magnesium conditions

    • Measure N-glycosylation functionality for dual-function assessment

  • Structure-Function Correlation:

    • Map functional effects of mutations onto predicted structural models

    • Identify clusters of functionally important residues

    • Correlate mutation effects with evolutionary conservation patterns

    • Compare findings with known human MAGT1 mutations for translational relevance

This systematic mutagenesis approach can provide detailed insights into the molecular mechanisms of MAGT1-mediated magnesium transport and identify specific residues critical for its dual functions in magnesium homeostasis and N-glycosylation.

How can recombinant chicken MAGT1 be used to study compensatory magnesium transport mechanisms?

Recombinant chicken MAGT1 provides an excellent model system for investigating compensatory magnesium transport mechanisms:

  • Combinatorial Expression Studies:

    • Express MAGT1 alongside other Mg2+ transporters (e.g., SLC41A2) in TRPM7−/− cells

    • Assess whether multiple transporters can fully compensate for TRPM7 deficiency

    • Determine if different transporters have additive or synergistic effects on Mg2+ homeostasis

  • Tissue-Specific Compensation Patterns:

    • Compare MAGT1 upregulation patterns across different cell types (e.g., immune cells, epithelial cells)

    • Investigate why some tissues show MAGT1 upregulation under hypomagnesic conditions while others do not

    • Identify transcriptional regulators that control tissue-specific MAGT1 expression

  • Temporal Dynamics of Compensation:

    • Study the time course of MAGT1 upregulation following magnesium depletion

    • Determine how quickly compensatory mechanisms are activated

    • Assess whether chronic vs. acute magnesium deficiency triggers different compensatory responses

  • Signaling Pathway Analysis:

    • Investigate how cells sense magnesium deficiency in the absence of TRPM7

    • Identify signaling pathways that link magnesium sensing to MAGT1 upregulation

    • Use pharmacological inhibitors and genetic approaches to dissect these pathways

  • Cross-Species Comparative Studies:

    • Compare compensatory patterns between chicken MAGT1 and its mammalian counterparts

    • Identify conserved vs. species-specific aspects of magnesium transport compensation

    • Relate findings to evolutionary adaptation in magnesium homeostasis mechanisms

This research approach can provide valuable insights into how cellular systems maintain critical magnesium homeostasis through redundant and compensatory mechanisms, with potential implications for understanding magnesium-related pathologies and developing therapeutic strategies.

What role does recombinant chicken MAGT1 play in studying the relationship between magnesium transport and N-glycosylation?

Recombinant chicken MAGT1 offers a unique opportunity to investigate the dual role of MAGT1 in magnesium transport and N-glycosylation processes:

  • Functional Domain Mapping:

    • Create domain-specific mutations or truncations in recombinant chicken MAGT1

    • Assess each construct for magnesium transport capability versus N-glycosylation function

    • Determine whether these two functions reside in distinct structural domains or are interdependent

  • Magnesium-Glycosylation Relationship Analysis:

    • Manipulate extracellular and intracellular magnesium levels

    • Measure corresponding changes in N-glycosylation efficiency of STT3B-dependent proteins

    • Determine whether magnesium transport function directly impacts glycosylation processes

  • Cell-Type Specific Dependencies:

    • Compare the impact of MAGT1 deficiency on glycosylation patterns in immune cells versus other cell types

    • Identify cell-specific glycoproteins that critically depend on MAGT1 function

    • Explain why immune cells show heightened sensitivity to MAGT1 deficiency

  • Evolutionary Conservation Studies:

    • Compare chicken MAGT1 with human and other vertebrate MAGT1 proteins

    • Assess conservation of dual functionality across species

    • Identify species-specific adaptations in either magnesium transport or glycosylation functions

  • Disease Model Development:

    • Use chicken MAGT1 variants modeling human disease mutations (like those in XMEN syndrome)

    • Assess specific impacts on magnesium transport versus glycosylation

    • Correlate functional deficits with disease phenotypes

This research direction can provide crucial insights into the molecular interface between magnesium homeostasis and protein glycosylation, potentially revealing how these distinct cellular processes have become interconnected through MAGT1 and explaining the complex phenotypes observed in MAGT1 deficiency disorders.

What are common challenges in expressing recombinant chicken MAGT1 and how can they be overcome?

Researchers working with recombinant chicken MAGT1 often encounter several challenges that can be addressed through specific methodological approaches:

  • Low Expression Levels:

    • Challenge: Membrane proteins like MAGT1 often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the host cell system; use strong promoters (e.g., CMV); incorporate enhancer elements; consider inducible expression systems like the tetracycline-regulated system used for TRPM7 expression .

  • Protein Misfolding:

    • Challenge: Improper folding can lead to non-functional MAGT1 despite detectable expression.

    • Solution: Grow cells at lower temperatures (30-32°C) during expression; add chemical chaperones to culture media; consider fusion tags that enhance solubility while maintaining function.

  • Detection Difficulties:

    • Challenge: Detecting native MAGT1 can be challenging due to low expression or antibody limitations.

    • Solution: Use epitope tags like the C-terminal FLAG tag, which has been successfully employed without disrupting function; optimize immunoprecipitation conditions (0.5% Triton lysis buffer has proven effective) .

  • Functional Verification:

    • Challenge: Confirming that expressed MAGT1 is functionally active.

    • Solution: Implement the Mag-fura fluorescence assay to measure Mg2+ uptake; assess growth complementation in TRPM7−/− cells under low magnesium conditions as a functional readout .

  • Clone Selection Variability:

    • Challenge: Variable expression levels across different clones.

    • Solution: Screen multiple independent clones (as demonstrated in Fig. 2A of the referenced study); select clones with moderate, stable expression over those with very high but potentially toxic expression levels .

By implementing these strategies, researchers can overcome common technical challenges and successfully express functional recombinant chicken MAGT1 for subsequent experimental investigations.

How should researchers interpret contradictory results when studying MAGT1 in different experimental systems?

When encountering contradictory results in MAGT1 research across different experimental systems, researchers should consider the following interpretative framework:

  • Cell Type-Specific Regulation:

    • Observation: Studies show that MAGT1 expression is upregulated in some cell types under hypomagnesic conditions (DT40 cells) but remains unchanged or is downregulated in others (mammary epithelial cells, rumen epithelial cells) .

    • Interpretation: These are likely genuine biological differences rather than experimental artifacts, reflecting tissue-specific regulatory mechanisms. Different cell types may rely on distinct magnesium homeostasis strategies.

    • Approach: Compare experimental methods critically but accept that biological variation exists; characterize the regulatory mechanisms in each cell type.

  • Partial vs. Complete Rescue Phenomena:

    • Observation: MagT1 only partially rescues TRPM7−/− phenotypes, while complete rescue might be expected if both are magnesium transporters .

    • Interpretation: TRPM7 and MAGT1 likely have distinct biological properties beyond simple magnesium transport, including different transport kinetics, regulation, or additional functions.

    • Approach: Design experiments to characterize the specific properties of each transporter; investigate whether combinations of transporters provide more complete rescue.

  • Magnesium Concentration Dependencies:

    • Observation: MAGT1 effects may vary depending on the extracellular magnesium concentration used in experiments.

    • Interpretation: Different transporters may operate optimally at different magnesium concentrations, reflecting their physiological roles.

    • Approach: Always test a range of magnesium concentrations (e.g., 0.5, 10, and 20 mM) to capture the full response profile .

  • Species-Specific Differences:

    • Observation: Chicken MAGT1 may show different properties than human or other mammalian MAGT1.

    • Interpretation: These differences may reflect evolutionary adaptations to species-specific physiological requirements.

    • Approach: Perform careful cross-species comparative studies; avoid generalizing findings from one species to another without verification.

  • Dual Functionality Considerations:

    • Observation: MAGT1 effects on magnesium transport may not correlate with effects on N-glycosylation functions.

    • Interpretation: These represent distinct molecular functions that may be differentially affected by experimental conditions or mutations.

    • Approach: Always assess both functions independently when characterizing MAGT1 activity .

By carefully considering these interpretative frameworks, researchers can reconcile apparently contradictory results and develop a more nuanced understanding of MAGT1 biology across different experimental systems.

What are promising areas for future research on recombinant chicken MAGT1?

Several promising research directions can advance our understanding of recombinant chicken MAGT1 and its biological significance:

  • Complete Complementation Studies:

    • Investigate whether combinations of multiple magnesium transporters (MAGT1, SLC41A2, others) can completely rescue TRPM7 deficiency

    • Determine the minimal set of transporters needed for full magnesium homeostasis

    • Explore potential synergistic interactions between different transport systems

  • Structural Biology Approaches:

    • Determine the three-dimensional structure of chicken MAGT1 using X-ray crystallography or cryo-electron microscopy

    • Map the magnesium conduction pathway through the protein

    • Identify structural features that distinguish MAGT1 from other magnesium transporters

  • Regulatory Network Mapping:

    • Characterize the transcriptional and post-translational regulatory mechanisms controlling MAGT1 expression and activity

    • Identify the magnesium-sensing mechanisms that operate independently of TRPM7

    • Map cell-type specific differences in MAGT1 regulation

  • N-Glycosylation Function Exploration:

    • Determine how MAGT1 participates in the oligosaccharyltransferase complex

    • Identify specific glycoproteins dependent on MAGT1-facilitated N-glycosylation

    • Investigate whether magnesium transport and glycosylation functions can be separated

  • CRISPR-Cas9 Modified Cell Lines:

    • Generate precise chicken MAGT1 mutations modeling human disease variants

    • Create cell lines with conditional MAGT1 expression systems

    • Develop reporter systems to monitor MAGT1 activity in real-time

  • Therapeutic Application Research:

    • Explore whether MAGT1 overexpression could compensate for other magnesium transport deficiencies

    • Investigate small molecule enhancers of MAGT1 activity

    • Develop strategies to regulate MAGT1 expression in a tissue-specific manner

These research directions build upon current knowledge while addressing significant gaps in our understanding of MAGT1 biology, potentially leading to therapeutic applications for magnesium-related disorders.

How might comparative studies between chicken and human MAGT1 contribute to understanding magnesium transport disorders?

Comparative studies between chicken and human MAGT1 offer valuable insights into magnesium transport disorders through several key approaches:

  • Evolutionary Conservation Analysis:

    • Identify highly conserved residues between chicken and human MAGT1

    • These conserved elements likely represent functionally critical domains

    • Mutations in these conserved regions are most likely to cause disease phenotypes

    • This approach can help prioritize variants of uncertain significance in human patients

  • Functional Rescue Experiments:

    • Test whether chicken MAGT1 can rescue defects in human cells with MAGT1 mutations

    • Conversely, assess whether human MAGT1 complements chicken MAGT1 deficiency

    • These cross-species complementation studies can reveal functional conservation and species-specific adaptations

  • Disease Mutation Modeling:

    • Introduce mutations equivalent to human disease variants (like those in XMEN syndrome) into chicken MAGT1

    • Assess functional consequences in the TRPM7−/− DT40 system

    • Use this model to screen for potential therapeutic approaches

  • Tissue-Specific Regulation Comparison:

    • Compare regulatory mechanisms of MAGT1 expression across species

    • Identify conserved versus species-specific regulatory elements

    • This may explain differential tissue sensitivity to MAGT1 dysfunction in humans versus animal models

  • Pharmacological Response Profiling:

    • Test how chicken versus human MAGT1 respond to potential therapeutic compounds

    • Identify compounds that enhance MAGT1 function across species

    • Use cross-species conservation as a predictor of therapeutic efficacy in humans

  • Structure-Function Relationship Translation:

    • Map functional domains in chicken MAGT1

    • Translate findings to the human protein through homology

    • Develop targeted approaches to address specific functional deficits in human disease variants

These comparative approaches leverage the experimental advantages of the chicken model system while maintaining translational relevance to human disease, potentially accelerating the development of therapeutic strategies for magnesium transport disorders like XMEN syndrome.

What are the key takeaways about recombinant chicken MAGT1 for researchers new to this field?

For researchers entering the field of recombinant chicken MAGT1 research, several key concepts provide a foundation for understanding this important magnesium transporter:

  • Dual Functionality: MAGT1 serves both as a selective plasma membrane Mg2+ transporter and as an accessory protein for the oligosaccharyltransferase complex involved in N-glycosylation, making it a multifunctional protein with critical roles beyond simple ion transport .

  • Compensatory Mechanism: MAGT1 expression increases in response to magnesium deficiency, particularly in TRPM7-deficient cells, indicating its role in compensatory magnesium homeostasis. This upregulation mechanism appears to function independently of TRPM7, suggesting multiple magnesium-sensing pathways in cells .

  • Partial Rescue Capability: Overexpression of recombinant MAGT1 in TRPM7−/− cells partially rescues both magnesium uptake capacity and cell growth under physiological magnesium conditions, demonstrating functional complementation between different magnesium transport systems .

  • Experimental Model System: The TRPM7−/− DT40 cell system provides an excellent model for studying MAGT1 function, as these cells require supraphysiological magnesium supplementation for survival unless complemented with functional magnesium transporters .

  • Tissue-Specific Regulation: MAGT1 expression responds differently to magnesium deficiency across various cell types, highlighting the importance of tissue context in magnesium homeostasis mechanisms .

  • Disease Relevance: Mutations in MAGT1 cause XMEN syndrome in humans, characterized by immunodeficiency, magnesium defects, and increased susceptibility to viral infections and neoplasia, underscoring the critical importance of this protein in immune function .

These fundamental concepts provide new researchers with the essential background to design experiments, interpret results, and contribute meaningfully to this evolving field of research.

How does current research on recombinant chicken MAGT1 contribute to our broader understanding of magnesium homeostasis?

Research on recombinant chicken MAGT1 has significantly expanded our understanding of magnesium homeostasis in several important ways:

  • Multiple Transport Systems: Studies demonstrating partial rescue of TRPM7 deficiency by MAGT1 overexpression reveal that cells employ multiple, partially redundant systems for magnesium homeostasis. This suggests a layered approach to maintaining this critical electrolyte, with different transporters potentially specialized for different conditions or cellular compartments .

  • Regulatory Network Insights: The finding that MAGT1 upregulation occurs independently of TRPM7 indicates the existence of multiple magnesium-sensing mechanisms within cells. This challenges the view of TRPM7 as the sole "master regulator" of cellular magnesium and suggests a more distributed regulatory network .

  • Integration with Protein Processing: The dual role of MAGT1 in both magnesium transport and N-glycosylation represents an unexpected integration between ion homeostasis and protein processing pathways. This connection may explain why magnesium deficiency can have such widespread effects on cellular function .

  • Tissue-Specific Adaptation: The observation that different cell types regulate MAGT1 differently in response to magnesium deficiency highlights how magnesium homeostasis mechanisms are adapted to tissue-specific requirements .

  • Evolutionary Conservation: Studies of chicken MAGT1 in comparison with mammalian orthologs reveal evolutionarily conserved aspects of magnesium transport, suggesting fundamental mechanisms that have been preserved across vertebrate evolution .

  • Disease Mechanism Elucidation: Research using recombinant MAGT1 has helped explain how MAGT1 deficiency leads to conditions like XMEN syndrome, revealing connections between magnesium transport, glycosylation, immune receptor expression, and antiviral immunity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.