Recombinant Chicken Melatonin receptor type 1A

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor; CKA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Protein Sequence
MRANGSELNGTVLPRDPPAEGSPRRPPWVTSTLATILIFTIVVDLLGNLLVILSVYRNKK LRNAGNIFVVSLAIADLVVAIYPYPLVLTSVFHNGWNLGYLHCQISGFLMGLSVIGSIFN ITGIAINRYCYICHSLKYDKLYSDKNSLCYVGLIWVLTVVAIVPNLFVGSLQYDPRIYSC TFAQSVSSAYTIAVVFFHFILPIAIVTYCYLRIWILVIQVRRRVKPDNNPRLKPHDFRNF VTMFVVFVLFAVCWAPLNFIGLAVAVDPETIIPRIPEWLFVSSYYMAYFNSCLNAIIYGL LNQNFRREYKKIVVSFCTAKAFFQDSSNDAADRIRSKPSPLITNNNQVKVDSV
Uniprot No.

Target Background

Function
High affinity receptor for melatonin. The activity of this receptor is mediated by pertussis toxin-sensitive G proteins, which inhibit adenylate cyclase activity.
Database Links

KEGG: gga:396319

STRING: 9031.ENSGALP00000022058

UniGene: Gga.762

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in optic tectum and retina, less in neostriatum, hypothalamus and thalamus.

Q&A

What tissue distribution pattern does chicken MTNR1A exhibit?

Expression studies have demonstrated that chicken MTNR1A mRNAs are predominantly found in brain and kidney tissues, with trace expression levels detected in the lung . This distribution pattern differs somewhat from mammalian systems, providing researchers with an opportunity to investigate tissue-specific melatonin signaling across species. Within the brain, expression patterns may correlate with regions involved in circadian rhythm regulation, though detailed mapping requires further investigation using techniques such as in situ hybridization or immunohistochemistry with specific antibodies.

What are the functional characteristics of recombinant chicken MTNR1A?

Recombinant chicken MTNR1A binds melatonin with high affinity, though binding studies using chimeric receptors indicate approximately 10-fold lower affinity for melatonin and its analogs compared to mammalian receptors . The receptor demonstrates G protein-dependent signaling, evidenced by guanine nucleotide-sensitive binding. Functionally, chicken MTNR1A activation leads to inhibition of adenylate cyclase activity through pertussis toxin-sensitive G proteins, similar to mammalian melatonin receptors . Notably, research has demonstrated that melatonin potently inhibits dopamine D1A-receptor-mediated cAMP accumulation in cells co-expressing these receptors, indicating important cross-talk between melatonin and dopamine signaling pathways .

What expression systems are optimal for recombinant chicken MTNR1A production?

Multiple expression systems have been utilized for recombinant chicken MTNR1A, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coli- High yield
- Cost-effective
- Simple scale-up
- Lacks post-translational modifications
- May form inclusion bodies
- Often requires refolding
- Antigen production
- Structural studies
- Binding assays
Mammalian cells (HEK-293, COS-7)- Proper folding
- Native-like post-translational modifications
- Functional expression
- Lower yield
- Higher cost
- Technical complexity
- Functional studies
- Signaling assays
- Drug screening
Insect cells (Sf9, High Five)- Higher yield than mammalian systems
- Some post-translational modifications
- Good for membrane proteins
- Not identical to mammalian modifications
- Moderate cost
- Structural biology
- Large-scale protein production

For functional studies, mammalian expression systems such as COS-7 or HEK-293 cells have proven effective, as demonstrated in research using these cell lines for transient expression of chimeric frog/chicken melatonin receptors . For applications requiring larger amounts of protein such as structural studies, prokaryotic expression in E. coli can produce substantial quantities of protein, though often limited to specific domains or with fusion tags to enhance solubility .

What strategies can overcome challenges in functional expression of chicken MTNR1A?

A notable strategy to achieve functional expression of chicken MTNR1A involves the creation of chimeric receptors. Researchers have successfully constructed a chimeric frog/chicken melatonin receptor by substituting the 5' end of the chicken receptor, including the N-terminus, transmembrane domain 1 (TM1), and part of the first intracellular loop with the corresponding frog melatonin receptor sequence . This approach yielded a receptor that bound [125I]Iodo-melatonin with high affinity (Kd of approximately 35 pM) in a saturable and guanine nucleotide-sensitive manner . Additional strategies include codon optimization for the expression system of choice, use of appropriate signal peptides, and inclusion of stabilizing modifications or fusion partners such as the N-terminal His tag employed in commercially available recombinant proteins .

What binding assay protocols are recommended for studying chicken MTNR1A pharmacology?

Radioligand binding assays using [125I]Iodo-melatonin represent the gold standard for characterizing chicken MTNR1A binding properties. When performing such assays, researchers should consider the following methodological recommendations:

  • Use saturation binding experiments to determine Kd values (approximately 35 pM for chimeric frog/chicken receptor) .

  • Implement competition binding assays to establish rank order potency for various ligands.

  • Include guanine nucleotides (e.g., GTP-γ-S) in parallel assays to assess G protein coupling.

  • Compare binding parameters between recombinant systems and native chicken brain membranes to validate physiological relevance.

Previous research has established the following rank order of potency for melatonin and analogs at the chimeric frog/chicken receptor: 2-iodo-ML > ML > 6-Cl-ML > S20750 > 6-OH-ML > S20642 > S20753 > N-acetyl-5HT >> 5-HT . This pharmacological profile serves as a reference point for validating newly produced recombinant proteins and for designing receptor subtype-selective compounds.

How can structural differences between chicken and mammalian MTNR1A inform drug discovery?

The distinct pharmacological profile of chicken MTNR1A compared to mammalian receptors provides a valuable platform for structure-function studies aimed at identifying critical binding determinants. Research has shown that chicken MTNR1A exhibits approximately 10-fold lower affinity for melatonin and analogs like 6-Cl-ML and 6-OH-ML compared to mammalian receptors . By systematically analyzing these differences through site-directed mutagenesis, researchers can identify amino acid residues and structural motifs that regulate melatonin binding specificity and affinity .

Comparative molecular modeling of chicken and mammalian receptors can highlight divergent regions that might serve as targets for species-selective compounds. Such compounds could be valuable for investigating melatonin-dependent processes in mixed-species cell cultures or for developing veterinary applications with reduced cross-reactivity in humans. The availability of recombinant chicken MTNR1A also enables high-throughput screening approaches to identify novel ligands with distinct selectivity profiles.

What signaling pathways are mediated by chicken MTNR1A?

Chicken MTNR1A primarily couples to pertussis toxin-sensitive G proteins (Gi/Go) that inhibit adenylate cyclase activity, leading to reduced intracellular cAMP levels . Beyond this canonical pathway, research has revealed important interactions with other signaling systems:

Signaling PathwayKey FindingsPotential Applications
cAMP/PKA PathwayInhibition of adenylate cyclase via Gi/Go proteins- Circadian rhythm regulation
- Reproductive physiology
Dopamine D1A Receptor Cross-talkMelatonin potently inhibits D1A-receptor-mediated cAMP accumulation- Interactions between melatonin and dopaminergic systems
- Behavioral regulation
Ca2+ SignalingPotential modulation of intracellular calcium levels (requires further investigation)- Neuronal excitability
- Secretory processes
MAPK PathwayPossible activation through βγ subunits (based on mammalian studies)- Cell proliferation
- Gene expression regulation

Of particular interest is the opposing interaction between melatonin and dopamine receptor signal transduction pathways observed in HEK-293 cells transiently co-expressing these receptors . This finding suggests complex interplay between different neuromodulatory systems in the avian brain, with potential implications for understanding circadian regulation of behavior and physiology.

How do developmental and seasonal factors affect chicken MTNR1A expression and function?

While specific data on developmental and seasonal regulation of chicken MTNR1A is limited in the provided search results, this represents an important research area for investigators studying avian circadian biology. The following methodological approaches are recommended:

  • Quantitative PCR analysis of MTNR1A mRNA across embryonic and post-hatching developmental stages.

  • Immunohistochemistry using specific antibodies (such as the biotin-conjugated polyclonal antibody described in result , if cross-reactivity with chicken MTNR1A is confirmed).

  • Radioligand binding assays to quantify receptor density and affinity throughout development.

  • Functional assays (cAMP accumulation, GTPγS binding) to assess receptor coupling efficiency across different conditions.

Seasonal variations in photoperiod significantly impact melatonin secretion in birds, potentially leading to adaptive changes in receptor expression or sensitivity. Experimental designs should include careful control of lighting conditions and consideration of seasonal breeding status when investigating MTNR1A function in avian species.

What are common challenges in working with recombinant chicken MTNR1A?

Researchers working with recombinant chicken MTNR1A should be aware of several technical challenges that may impact experimental outcomes:

  • Expression difficulties: As a membrane protein, full-length MTNR1A can be challenging to express in functional form. The successful chimeric approach with frog receptor sequences suggests that certain domains of the chicken receptor may be particularly problematic for heterologous expression.

  • Proper folding: G protein-coupled receptors require correct folding and membrane insertion for functionality. When expressing in E. coli, consider using fusion partners that enhance membrane targeting or solubility. For protein fragments expressed in prokaryotic systems (like the Gly299~Val353 fragment mentioned in result ), refolding protocols may be necessary.

  • Post-translational modifications: Native MTNR1A likely undergoes several post-translational modifications that might be absent in prokaryotic expression systems. For applications requiring fully functional receptor, mammalian expression systems may be preferable despite lower yields.

  • Storage stability: Recombinant proteins containing membrane-spanning regions often show reduced stability during storage. Follow recommendations for storage at -20°C or -80°C and avoid repeated freeze-thaw cycles . Inclusion of stabilizing agents such as glycerol or trehalose in storage buffers can improve long-term stability.

How can researchers validate that recombinant chicken MTNR1A retains native-like properties?

To ensure that recombinant chicken MTNR1A accurately represents the native receptor, validation should include multiple complementary approaches:

  • Pharmacological profile comparison: Compare the rank order of potency and binding affinities of various ligands between the recombinant receptor and native chicken brain membranes, as demonstrated in previous research .

  • Functional coupling: Verify that the recombinant receptor couples to appropriate G proteins by measuring inhibition of forskolin-stimulated cAMP production or by conducting GTPγS binding assays.

  • Antibody recognition: Confirm that antibodies against specific epitopes of the receptor (such as the polyclonal antibody mentioned in result ) recognize both the recombinant and native proteins in Western blot or immunoprecipitation experiments.

  • Mutagenesis studies: Introduce point mutations at conserved residues known to be crucial for ligand binding or G protein coupling in other melatonin receptors, and verify that these mutations produce the expected effects on receptor function.

What experimental controls are essential for studies using chicken MTNR1A?

Rigorous experimental design requires appropriate controls to ensure valid interpretation of results:

Control TypePurposeImplementation
Negative Expression ControlVerify specificity of observed signals- Mock-transfected cells
- Cells expressing unrelated receptor
Positive ControlConfirm assay functionality- Well-characterized mammalian melatonin receptor
- Native chicken brain membrane preparations
Pharmacological ControlsValidate receptor-specific responses- Competitive antagonists
- Structurally diverse melatonin analogs
G Protein Coupling ControlVerify signaling mechanism- Pertussis toxin treatment
- GTPγS inclusion in binding assays
Antibody Specificity ControlEnsure specificity in immunological applications- Blocking peptides
- Pre-immune serum
- Western blots showing expected molecular weight

When using recombinant proteins for immunological studies, researchers should verify purity by SDS-PAGE and consider the potential impact of fusion tags or expression artifacts on experimental outcomes.

What insights does chicken MTNR1A provide about melatonin receptor evolution?

The greater sequence homology between chicken and amphibian (Xenopus) melatonin receptors compared to mammalian receptors offers interesting evolutionary perspectives . This pattern suggests either evolutionary divergence in the mammalian lineage or conservation of ancient receptor characteristics in non-mammalian vertebrates. Comparative studies across multiple species can help elucidate the selective pressures that have shaped melatonin receptor structure and function through evolutionary time.

The approximately 10-fold lower affinity of chicken MTNR1A for melatonin and certain analogs compared to mammalian receptors may reflect adaptation to different physiological requirements or environmental conditions. Birds and mammals diverged approximately 310 million years ago, allowing substantial time for independent evolution of their melatonin signaling systems in response to different selective pressures related to circadian biology, seasonal reproduction, and other melatonin-regulated processes.

How can cross-species comparisons advance melatonin receptor research?

Systematic comparison of melatonin receptors across species provides powerful approaches for addressing fundamental questions in receptor biology:

  • Structure-function relationships: By correlating sequence differences with pharmacological properties across species, researchers can identify critical determinants of ligand binding and receptor activation without extensive mutagenesis.

  • Physiological adaptations: Differences in receptor pharmacology or tissue distribution may reflect species-specific adaptations in circadian regulation or seasonal responses to changing day length.

  • Drug discovery applications: Species differences in ligand binding pockets can inform the design of selective compounds for research or therapeutic applications.

The availability of cloned vertebrate melatonin receptors that differ at both amino acid and pharmacological levels from their mammalian counterparts facilitates identification of amino acid residues and structural motifs that regulate melatonin binding specificity and affinity . This comparative approach complements traditional structure-function studies and may accelerate discovery of receptor regions critical for selective drug targeting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.