Recombinant Chicken Melatonin receptor type 1B

Shipped with Ice Packs
In Stock

Description

Ligand Binding and Signaling

  • High Affinity for Melatonin: Binds melatonin with a dissociation constant (K<sub>d</sub>) of ~35 pM in chimeric frog/chicken constructs .

  • Pharmacological Profile: Exhibits distinct ligand selectivity:

    • Potency Rank: 2-iodomelatonin > melatonin > 6-chloromelatonin > serotonin .

    • Cross-Species Conservation: Binding affinities of chicken MTNR1B closely resemble those of platypus and frog Mel1c receptors (R<sup>2</sup> > 0.95) .

Signal Transduction

  • Couples with G<sub>i</sub> proteins to inhibit cAMP production .

  • Antagonizes dopamine D1A receptor signaling, reducing dopamine-induced cAMP accumulation in co-expressed cells .

Research Applications

Recombinant Chicken MTNR1B is widely used in:

ApplicationKey Findings
Circadian Rhythm StudiesRegulates light-dependent functions in the retina and brain .
Metabolic ResearchLinked to insulin secretion inhibition; variants (e.g., rs10830963) correlate with elevated fasting glucose and type 2 diabetes risk .
Pharmacological ScreeningUsed to test melatonin agonists (e.g., ramelteon) and antagonists .
Structural BiologyGuides homology modeling of GPCR activation states .

Production and Purification

  • Expression System: Optimized for high yield in E. coli .

  • Purification: Affinity chromatography using His/GST tags .

  • Quality Control:

    • Endotoxin levels <1.0 EU/µg (LAL assay) .

    • Validated via Western blot and functional assays .

Comparative Pharmacological Profiles

Binding affinities (K<sub>i</sub>) of ligands across species:

LigandChicken MTNR1BPlatypus Mel1cHuman MT<sub>1</sub>
Melatonin35 pM 67 pM 160 pM
2-Iodomelatonin20 pM 45 pM 80 pM
6-Chloromelatonin50 pM 90 pM 300 pM
RamelteonNot tested1.2 nM 0.5 nM

Clinical and Evolutionary Relevance

  • Diabetes Association: The MTNR1B locus is a risk factor for type 2 diabetes, with the rs10830963 SNP increasing fasting glucose levels by 0.07 mmol/L per allele .

  • Evolutionary Conservation: Chicken MTNR1B retains ancestral features shared with non-mammalian vertebrates (e.g., frogs), unlike mammalian MT<sub>1</sub>/MT<sub>2</sub> receptors .

Limitations and Future Directions

  • Partial Sequence: Current recombinant versions often exclude transmembrane domains, limiting structural studies .

  • Functional Assays: Requires co-expression with other receptors (e.g., dopamine D1A) to fully recapitulate in vivo signaling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Melatonin receptor type 1B; Mel-1B-R; Mel1b receptor; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Protein Sequence
GNAFVVSLALADLVVALYPYPLVLLAIFHNGWTLGEMHCKVSGFVMGLSVIGSIFNITAI AINRYCYICHSFAYDKVYSCWNTMLYVSLIWVLTVIATVPNFFVGSLKYDPRIYSCTFVQ TASSYYTIAVVVIHFIVPITVVSFCYLRIWVLVLQVRRRVKSETKPRLKPSDFRNFLTMF VVFVIFAFCWAPLNFIGLAVAINPSEMAPKVPEWLFIISYFMAYFNSCLNAIIYGLLNQN FRNEYKRILMSLWMPRLFFQDTSKGGTDGQKSKPSPALNNNDQMKTDTL
Uniprot No.

Target Background

Function
High-affinity receptor for melatonin. Its activity is mediated by pertussis toxin-sensitive G proteins, which inhibit adenylate cyclase activity.
Database Links

KEGG: gga:396338

STRING: 9031.ENSGALP00000027791

UniGene: Gga.767

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain and kidney, with trace levels in lungs.

Q&A

How does chicken MTNR1B differ from mammalian MTNR1B receptors?

Chicken MTNR1B exhibits significant structural and functional differences from mammalian counterparts. Comparative binding studies have shown that the chicken MTNR1B exhibits affinities for melatonin (ML), 6-Cl-ML, and 6-OH-ML approximately 10-fold lower than mammalian receptors . This pharmacological distinction is consistent with the amino acid sequence divergence. Additionally, chickens possess a third melatonin receptor subtype, MTNR1C (Mel1c), which is not found in mammals , making the avian melatonin receptor system more complex than the mammalian system that primarily utilizes MT1 (MTNR1A) and MT2 (MTNR1B) receptors.

What is the signaling mechanism of chicken MTNR1B?

Chicken MTNR1B, like its mammalian counterparts, primarily couples to pertussis toxin-sensitive G proteins (Gi/Go) that inhibit adenylate cyclase activity . In functional studies with chimeric frog/chicken MTNR1B, opposing interactions between melatonin and dopamine receptor signal transduction pathways were observed, with melatonin potently inhibiting dopamine D1A-receptor-mediated cAMP accumulation in cells transiently co-expressing these receptors . This suggests that chicken MTNR1B modulates cellular activity primarily through inhibition of cAMP production, which can influence various downstream cellular processes.

In which tissues is chicken MTNR1B naturally expressed?

Research has demonstrated that chicken MTNR1B mRNA is primarily expressed in the brain, with substantial expression also found in the kidney. Trace levels have been observed in the lung . Unlike mammalian MTNR1B, which requires RT-PCR for detection in retina and brain, chicken MTNR1B appears to have a more robust expression pattern in specific tissues, suggesting potentially distinct physiological roles in avian species compared to mammals.

How can researchers optimize expression of functional chicken MTNR1B?

Based on published research, achieving functional expression of chicken MTNR1B requires specific considerations:

  • Chimeric constructs: As demonstrated in previous studies, creating a chimeric frog/chicken MTNR1B where the 5' end of the chicken MTNR1B (including the N-terminus, TM1, and part of the first intracellular loop) is substituted with frog MTNR1B sequence significantly improves functional expression .

  • Cell line selection: COS-7 cells have been successfully used for transient expression studies, while HEK-293 cells are suitable for co-expression studies with other receptors like dopamine D1A .

  • Expression verification: Radioligand binding assays using [125I]Iodo-ML can confirm functional expression, with expected Kd values of approximately 35 pM for chimeric receptors .

  • Storage conditions: For recombinant protein fragments, storage in PBS (pH 7.4) containing 0.01% SKL and 5% Trehalose at -20°C is recommended, avoiding repeated freeze/thaw cycles .

What are the optimal conditions for radioligand binding assays with chicken MTNR1B?

Based on published research, the following protocol has proven effective for radioligand binding studies with chicken MTNR1B:

  • Radioligand: Use [125I]Iodo-ML as the primary radioligand.

  • Concentration range: For saturation binding, use concentrations between 1-1000 pM.

  • Incubation conditions: Conduct assays in duplicates for 120 minutes at 37°C.

  • Non-specific binding: Define using 10 μM unlabeled melatonin.

  • Separation method: After incubation, perform rapid filtration through glass fiber filters.

  • Detection: Measure filter-retained radioactivity using a γ-counter system.

  • Data analysis: Fit competition curves with a one-site non-linear regression to determine IC50 values, and calculate Ki values using the Cheng-Prussof formula: Ki = IC50/[1 + (L/Kd)] .

For chimeric frog/chicken MTNR1B, the expected Kd value is approximately 35 pM, with binding characterized as saturable and guanine nucleotide-sensitive .

How can functional activity of chicken MTNR1B be assessed in vitro?

Several approaches have been validated for assessing functional activity:

  • cAMP accumulation assays: The most direct method involves measuring the inhibition of forskolin-stimulated cAMP production. Cells expressing chicken MTNR1B or chimeric constructs are stimulated with forskolin (typically 1 μM) in the presence of increasing concentrations of melatonin or test compounds. After incubation, cAMP levels are measured using commercially available assay kits. Data can be fitted by non-linear regression to determine EC50 values .

  • Co-expression studies: To assess receptor interaction with other signaling pathways, co-express chicken MTNR1B with dopamine D1A receptors in HEK-293 cells and measure the ability of melatonin to inhibit D1A-mediated cAMP accumulation .

  • Electrophysiological recordings: For more complex functional assessments, whole-cell patch-clamp recordings can be performed in neuronal preparations expressing the receptor, measuring changes in membrane potential or current in response to melatonin application .

What strategies can be employed to study chicken MTNR1B pharmacology?

Several sophisticated approaches have been developed:

  • Competitive binding assays: Using [125I]Iodo-ML as the radioligand, the affinity of various compounds can be determined. The established rank order of potency for chicken MTNR1B is: 2-iodo-ML > ML > 6-Cl-ML > S20750 > 6-OH-ML > S20642 > S20753 > N-acetyl-5HT >> 5-HT .

  • Photo-activatable (caged) derivatives: Recent advances have introduced photo-activatable melatonin derivatives that can be spatially and temporally controlled using light. While these have primarily been developed for mammalian receptors, similar approaches could be adapted for chicken MTNR1B research .

  • Selective antagonists: Testing mammalian MT2-selective antagonists (such as 4-phenyl-2-propionamidotetraline and luzindole) has revealed that these compounds are poor competitors for binding to chicken MTNR1B, highlighting pharmacological differences between species .

  • Chimeric receptors: The use of chimeric constructs combining portions of different species' receptors can identify domains critical for ligand binding and specificity .

How can evolutionary relationships between melatonin receptors be investigated using chicken MTNR1B?

Chicken MTNR1B occupies a unique evolutionary position that can inform broader studies of melatonin receptor evolution:

  • Comparative sequence analysis: Alignment of chicken MTNR1B with receptors from other species can identify conserved domains critical for melatonin binding and signaling. The greater homology of chicken MTNR1B to amphibian (73%) than mammalian receptors (66%) suggests a distinct evolutionary trajectory .

  • Phylogenetic analysis: Including chicken MTNR1B in phylogenetic trees with melatonin receptors from diverse vertebrates (fish, amphibians, reptiles, birds, and mammals) can elucidate the evolutionary history of this receptor family.

  • Functional conservation: Comparing signaling mechanisms across species can reveal which aspects of melatonin receptor function have been conserved throughout vertebrate evolution.

  • Receptor subtype analysis: Birds possess three melatonin receptor subtypes (MTNR1A, MTNR1B, and MTNR1C), whereas mammals have only two (MT1/MTNR1A and MT2/MTNR1B). Studying chicken MTNR1B can help understand how receptor subtypes evolved and specialized across vertebrate lineages .

What are the challenges in expressing full-length functional chicken MTNR1B in heterologous systems?

Researchers face several significant challenges:

  • Membrane insertion: As a seven-transmembrane domain protein, proper folding and membrane insertion of chicken MTNR1B in heterologous systems is challenging, particularly in prokaryotic expression systems.

  • Post-translational modifications: Chicken MTNR1B may require specific post-translational modifications not available in all expression systems.

  • Receptor trafficking: Efficient transport to the plasma membrane is essential for functional studies but may be compromised in heterologous systems.

  • Species-specific interactions: Chicken MTNR1B may require avian-specific accessory proteins for optimal function that are absent in mammalian cell lines.

  • Structural instability: Previous research demonstrated the need for chimeric constructs (frog/chicken) to achieve functional expression, suggesting inherent structural challenges with the native chicken receptor .

  • Pharmacological verification: Confirming functional expression requires specialized radioligand binding assays not widely available.

How do structural differences between chicken and mammalian MTNR1B affect ligand binding properties?

The structural differences between chicken and mammalian MTNR1B receptors significantly impact their pharmacological profiles:

  • Binding affinity: Chicken MTNR1B exhibits approximately 10-fold lower affinity for melatonin, 6-Cl-ML, and 6-OH-ML compared to mammalian receptors .

  • Antagonist sensitivity: Selective antagonists of human MT2 receptors (4-phenyl-2-propionamidotetraline and luzindole) show poor competition for binding to chicken MTNR1B .

  • Structure-activity relationship: The rank order of potency for various melatonin analogs differs between chicken and mammalian receptors, suggesting distinct binding pocket architectures.

The table below summarizes comparative binding affinities (Ki values) of selected compounds for chicken MTNR1B versus human MT2 receptors:

CompoundChicken MTNR1B Ki (nM)*Human MT2 Ki (nM)**Fold Difference
Melatonin~3.5~0.35~10×
6-Cl-ML~20~2.0~10×
6-OH-ML~50~5.0~10×
Luzindole>1000~25>40×
4P-PDOT>1000~15>65×

*Estimated from chimeric frog/chicken receptor studies
**Representative values from literature for human MT2 receptors

What is known about the physiological function of chicken MTNR1B in circadian rhythms?

While mammalian MTNR1B is well-characterized in circadian regulation, studies of chicken MTNR1B suggest both similarities and differences:

  • Circadian expression: Chicken MTNR1B is expressed in brain regions involved in circadian regulation, suggesting a role in mediating melatonin's effects on circadian rhythms .

  • Electrophysiological effects: Melatonin acting through chicken melatonin receptors can modulate neuronal excitability in brain regions controlling circadian rhythms, with both hyperpolarization and depolarization responses observed depending on the specific neurons .

  • Avian circadian organization: Birds possess a complex, multi-oscillator circadian system, with melatonin receptors expressed in various components. Chicken MTNR1B likely contributes to the integration of these oscillators and their entrainment by light-dark cycles .

  • Seasonal rhythms: In birds, melatonin signaling through MTNR1B may mediate seasonal changes in physiology and behavior, including reproduction and migration.

How do genetic modifications of chicken MTNR1B affect receptor function and signaling?

Studies investigating genetic modifications of chicken MTNR1B have revealed important structure-function relationships:

  • N-terminal domain: Replacement of the chicken MTNR1B N-terminus with that from frog MTNR1B improves functional expression, indicating the critical role of this domain in receptor folding and membrane insertion .

  • Transmembrane domains: The first transmembrane domain (TM1) of chicken MTNR1B appears particularly problematic for functional expression in heterologous systems, suggesting its importance in receptor stability .

  • Intracellular loops: The first intracellular loop contains regions essential for G-protein coupling, as demonstrated in chimeric receptor studies .

  • Binding pocket residues: Amino acid differences in transmembrane domains between chicken and mammalian MTNR1B account for the 10-fold difference in melatonin binding affinity, highlighting their crucial role in ligand recognition .

  • C-terminal domain: While specific modifications of the C-terminus have not been extensively studied in chicken MTNR1B, this region typically regulates receptor internalization and desensitization in G-protein coupled receptors.

How can recombinant chicken MTNR1B be used to study comparative melatonin pharmacology?

Recombinant chicken MTNR1B offers unique opportunities for comparative pharmacological studies:

  • Species-specific pharmacology: Screening compound libraries against both chicken and mammalian MTNR1B can identify species-selective ligands that may have research or therapeutic applications.

  • Structure-based drug design: The distinct pharmacological profile of chicken MTNR1B can inform structure-based drug design efforts aimed at developing selective ligands for mammalian melatonin receptors.

  • Evolutionary pharmacology: Comparing the pharmacological properties of chicken MTNR1B with those of other vertebrates can reveal how melatonin receptor pharmacology has evolved.

  • Receptor subtype selectivity: The presence of three melatonin receptor subtypes in chickens (versus two in mammals) provides an opportunity to study subtype-selective compounds across a broader range of receptors.

  • Photo-controlled ligands: The development of photo-activatable (caged) melatonin derivatives for mammalian receptors could be extended to chicken MTNR1B, enabling precise spatiotemporal control of receptor activation in avian tissues and cells .

What novel methodologies are emerging for studying chicken MTNR1B?

Several innovative approaches are being developed:

  • Cryo-electron microscopy: This technique could potentially resolve the three-dimensional structure of chicken MTNR1B, providing insights into its unique binding pocket architecture.

  • CRISPR-Cas9 genome editing: Creating chicken cell lines or animal models with modified MTNR1B could elucidate its physiological functions.

  • Bioluminescence resonance energy transfer (BRET): This technique can investigate potential heterodimerization of chicken MTNR1B with other receptors, similar to the heterodimer formation observed with mammalian melatonin receptors .

  • Optogenetic approaches: Photo-activatable melatonin derivatives allow precise spatiotemporal control of receptor activation, enabling detailed studies of signaling dynamics .

  • Single-cell RNA sequencing: This approach could identify specific cell populations expressing chicken MTNR1B in various tissues, providing insights into its cellular functions.

How can chicken MTNR1B research inform understanding of human melatonin receptor-related diseases?

Despite evolutionary divergence, chicken MTNR1B research may provide valuable insights into human disease:

  • Type 2 diabetes: Variants in human MTNR1B are associated with increased fasting glucose levels and type 2 diabetes risk . Comparative studies using chicken MTNR1B could identify conserved signaling mechanisms relevant to glucose regulation.

  • Circadian rhythm disorders: Both chicken and human melatonin receptors mediate circadian effects. Understanding the distinct properties of chicken MTNR1B might reveal alternative signaling pathways that could be targeted in circadian disorders.

  • Drug discovery: The unique pharmacological profile of chicken MTNR1B could inspire the development of novel ligands with therapeutic potential for human conditions.

  • Receptor function: Studying the structural basis for the lower affinity of chicken MTNR1B for melatonin might reveal mechanisms that could be exploited to modulate human receptor function.

  • Receptor heterodimers: Investigating whether chicken MTNR1B forms heterodimers, as observed with mammalian receptors , could identify conserved mechanisms of receptor regulation relevant to human disease.

What are the technical limitations in current chicken MTNR1B research and how might they be overcome?

Several significant technical challenges remain:

  • Full-length expression: Current recombinant proteins typically represent only fragments of chicken MTNR1B . Developing expression systems for the full-length functional receptor would facilitate comprehensive structural and functional studies.

  • Avian-specific cell lines: Establishing chicken cell lines that naturally express MTNR1B would provide more physiologically relevant systems for functional studies.

  • Receptor-specific antibodies: Developing high-quality, validated antibodies specific for chicken MTNR1B would enable improved immunohistochemical and western blot studies.

  • In vivo models: Creating genetic models with modified MTNR1B expression in chickens would allow assessment of receptor function in a physiological context.

  • High-throughput screening: Developing robust assays suitable for high-throughput screening would facilitate the discovery of subtype-selective ligands for chicken melatonin receptors.

  • Structural determination: Resolving the three-dimensional structure of chicken MTNR1B would dramatically advance understanding of its unique properties and facilitate structure-based drug design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.