Recombinant Chicken Metallophosphoesterase 1 (MPPE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MPPE1; PGAP5; RCJMB04_12i13; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
MPPE1
Target Protein Sequence
MLSPNLTIVKNLPLKKRICFLLKLVCFVSSVLIFCEFFIYYLVIFQCRWPDVKRDAHTGN EETPASVLKAMFLADTHLLGEIKGHWLDKLRREWQMERSFQTALWLLQPDIVFILGDVFD EGKWDSPQAWADDVRRFQKMFKYPVTTELVVIVGNHDIGFHYEMTTYKVHRFEKVFNFTS GKLITRKGTNFVLVNSVAMEGDGCTLCRTAEAKLVALSHRLNCSLQEPNHPQKRCSDAEK PPASQPILLQHYPLYRKSDAECSGEDAAPPEEKNIPFKEKYDVLSQEASQKLLWWFRPRL ILSGHTHSACQVLHTGGIPEISIPSFSWRNRNNPSFIMGSITPTDFSLHKCFLPRESRVF AIYWAAGALLVVLVLAHFQLLTPPFYFAQRLISKHKAA
Uniprot No.

Target Background

Function

Metallophosphoesterase 1 (MPPE1) is essential for the transport of glycosylphosphatidylinositol (GPI)-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. It plays a crucial role in GPI-anchor maturation by removing an ethanolamine-phosphate (EtNP) side chain from the second mannose (Man2) residue of the GPI intermediate. This enzymatic activity is vital for efficient transport of GPI-anchored proteins.

Database Links
Protein Families
Metallophosphoesterase superfamily, MPPE1 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is Metallophosphoesterase 1 (MPPE1) and what is its primary function?

Metallophosphoesterase 1 (MPPE1) is a metallophosphoesterase enzyme that plays a crucial role in the transport of glycosylphosphatidylinositol (GPI)-anchored proteins from the endoplasmic reticulum to the Golgi apparatus. Specifically, MPPE1 functions in the lipid remodeling steps of GPI-anchor maturation by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second mannose (Man2) of the GPI intermediate . This removal is an essential step for the efficient transport of GPI-anchored proteins through the secretory pathway. MPPE1 is a member of the calcineurin-like phosphoesterase superfamily, which is involved in various biochemical reactions, particularly protein phosphorylation-dephosphorylation processes that modulate the functional properties of proteins .

How is recombinant Chicken MPPE1 typically produced for research purposes?

Recombinant Chicken MPPE1 for research applications is typically produced using expression systems that allow for the controlled synthesis of the protein in laboratory conditions. The process generally involves:

  • Cloning the MPPE1 gene from chicken tissue samples

  • Inserting the gene into an appropriate expression vector

  • Transforming host cells (commonly bacterial, yeast, or insect cells) with the vector

  • Inducing protein expression under optimized conditions

  • Purifying the expressed protein using chromatographic techniques

  • Validating protein identity and functionality through appropriate assays

The exact methodology may vary based on research requirements and experimental design considerations, but these steps represent the fundamental approach to producing recombinant MPPE1 for detailed biochemical and functional analyses.

What detection methods are available for studying Chicken MPPE1?

Several detection methods are available for studying Chicken MPPE1, with ELISA being one of the most commonly utilized approaches. The Chicken MPPE1 ELISA Kit employs a two-site sandwich ELISA technique to quantitate MPPE1 in samples. In this method:

  • An antibody specific for MPPE1 is pre-coated onto a microplate

  • Standards and samples are added to the wells, and any MPPE1 present binds to the immobilized antibody

  • After washing, a biotin-conjugated antibody specific for MPPE1 is added

  • Following another wash, Streptavidin-HRP is added to the wells

  • A substrate solution is added after washing, and color develops proportionally to the amount of MPPE1 bound

  • The color development is stopped, and intensity is measured

Other detection methods include Western blotting, immunohistochemistry, and PCR-based techniques for gene expression analysis. Each method offers distinct advantages depending on the specific research questions being addressed.

How does MPPE1 contribute to GPI-anchor protein processing and what are the implications for cellular signaling?

MPPE1 plays a specialized role in GPI-anchor protein processing by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second mannose (Man2) of the GPI intermediate . This step is critical for the proper maturation and subsequent transport of GPI-anchored proteins. The implications for cellular signaling are significant because:

  • GPI-anchored proteins function as receptors, adhesion molecules, and enzymes on cell surfaces

  • Alterations in MPPE1 activity may lead to improper localization of these proteins

  • Improper GPI-anchor processing can disrupt membrane microdomains (lipid rafts) where many signaling events are coordinated

  • Dysfunctional MPPE1 could potentially affect downstream phosphorylation events involved in cellular signaling pathways

Given that MPPE1 contains metal binding and active sites similar to serine/threonine phosphoprotein phosphatase catalytic subunits, it likely influences various cellular processes including gene expression, cell growth, and cell differentiation through its effects on protein phosphorylation .

What experimental approaches are most effective for characterizing MPPE1 substrate specificity?

Characterizing MPPE1 substrate specificity requires multifaceted experimental approaches:

  • In vitro phosphatase assays: Using purified recombinant MPPE1 with various potential substrates to directly measure enzyme activity. This typically involves:

    • Incubating MPPE1 with candidate substrates under varying conditions (pH, temperature, metal cofactors)

    • Measuring the release of phosphate groups using colorimetric or fluorometric methods

    • Analyzing kinetic parameters (Km, Vmax) for different substrates

  • Structural biology approaches:

    • X-ray crystallography of MPPE1 alone and in complex with substrates

    • Molecular docking simulations to predict substrate binding

    • Site-directed mutagenesis of active site residues to identify critical amino acids

  • Cellular approaches:

    • Overexpression or knockout/knockdown of MPPE1 followed by phosphoproteomic analysis

    • Tracking GPI-anchored protein transport in cells with manipulated MPPE1 expression

    • Co-immunoprecipitation studies to identify interaction partners

  • Comparative analysis:

    • Comparing substrate preferences of MPPE1 from different species

    • Analyzing evolutionary conservation of substrate binding sites

Despite extensive characterization of many metallophosphoesterases, no natural substrate has been conclusively identified for MPPE1 outside its role in GPI-anchor processing , making this an important area for further research.

What is the relationship between MPPE1 genetic variations and neuropsychiatric disorders?

Research suggests a potential association between MPPE1 genetic variations and neuropsychiatric disorders, particularly bipolar disorder (BPD). A significant association has been observed between the single nucleotide polymorphism (SNP) rs3974590 in the MPPE1 gene and BPD (p=0.009; permutation corrected p=0.046) .

The biological mechanism underlying this association may involve:

  • MPPE1 is widely expressed in the brain and belongs to the calcineurin-like phosphoesterase superfamily

  • Variations in the MPPE1 gene might lead to altered enzyme activity affecting protein phosphorylation

  • Disruption in protein phosphorylation cascades could impact dopaminergic neurotransmission implicated in BPD

  • Abnormal cellular signaling resulting from dysregulated protein phosphorylation may contribute to neuropsychiatric disorder etiology

Table 1: Association of MPPE1 SNPs with Bipolar Disorder

SNPP-value (allelic)Permutation corrected p-valueAssociation status
rs39745900.0090.046Significant
rs5937130.051-Trend toward association
rs871044Not significant-No association
rs602201Not significant-No association

The MPPE1 gene is located on chromosome 18p11, a region previously implicated in BPD through genetic linkage studies. The evidence suggests that MPPE1 is a plausible biological candidate gene for BPD, though additional genetic, computational, and biological studies are necessary to fully elucidate its role in neuropsychiatric disorders .

What are the optimal conditions for maintaining MPPE1 enzymatic activity in experimental settings?

Maintaining optimal MPPE1 enzymatic activity in experimental settings requires careful consideration of several factors:

  • Buffer composition:

    • pH range: Typically 6.5-7.5 for metallophosphoesterases

    • Ionic strength: Usually 50-150 mM of salts like NaCl or KCl

    • Reducing agents: Addition of DTT or β-mercaptoethanol (0.5-2 mM) to prevent oxidation of cysteine residues

  • Metal cofactor requirements:

    • As a metallophosphoesterase, MPPE1 likely requires divalent metal ions for activity

    • Common cofactors include Mg²⁺, Mn²⁺, or Zn²⁺ at concentrations of 1-5 mM

    • Chelating agents (EDTA, EGTA) should be avoided as they can sequester necessary metal ions

  • Temperature and stability considerations:

    • Most enzymatic assays are conducted at 25-37°C

    • For long-term storage, enzyme should be kept at -80°C with glycerol (10-20%)

    • Avoid freeze-thaw cycles by preparing single-use aliquots

  • Protein concentration:

    • Working with higher protein concentrations (>0.1 mg/ml) often improves stability

    • Addition of carrier proteins (BSA) at 0.1-1 mg/ml can prevent surface adsorption

  • Inhibitor avoidance:

    • Phosphate buffers may inhibit phosphatase activity and should be replaced with alternatives like HEPES or Tris

    • Common detergents at high concentrations can denature the enzyme

These conditions should be optimized specifically for MPPE1 through systematic testing as the optimal conditions may vary based on the specific experimental context and source of the recombinant protein.

How can researchers design effective knockout or knockdown experiments to study MPPE1 function in avian cells?

Designing effective knockout or knockdown experiments to study MPPE1 function in avian cells requires careful consideration of several methodological aspects:

  • CRISPR-Cas9 genome editing for knockout studies:

    • Design multiple guide RNAs targeting coding regions of the MPPE1 gene

    • Validate guide RNA efficiency using prediction algorithms and in vitro cleavage assays

    • Optimize transfection protocols specifically for avian cells (electroporation often works well)

    • Screen for successful knockouts using sequencing, Western blotting, and enzymatic activity assays

    • Generate homozygous knockout cell lines through single-cell cloning

  • RNA interference (RNAi) for knockdown studies:

    • Design multiple siRNA or shRNA sequences targeting different regions of MPPE1 mRNA

    • Test knockdown efficiency using qRT-PCR and Western blotting

    • Consider using inducible systems (like Tet-On/Off) for temporal control

    • Include appropriate controls (scrambled siRNA, non-targeting shRNA)

  • Validation of phenotypic changes:

    • Assess GPI-anchored protein transport using fluorescent protein tags or specific antibodies

    • Examine subcellular localization patterns of GPI-anchored proteins

    • Quantify phosphorylation status of potential downstream targets

    • Monitor cellular responses to stimuli that involve GPI-anchored signaling receptors

  • Rescue experiments:

    • Reintroduce wild-type MPPE1 to confirm specificity of observed phenotypes

    • Use mutant versions (catalytically inactive) to identify important functional domains

    • Consider species-specific variations by testing mammalian MPPE1 in avian cells

  • Appropriate controls and data analysis:

    • Include wild-type cells as positive controls

    • Use cells treated with non-targeting constructs as negative controls

    • Apply appropriate statistical analyses to quantify differences

    • Consider possible compensatory mechanisms that might mask phenotypes

For microarray or RNA-seq analysis following manipulation of MPPE1 expression, approaches similar to those described in search result can be adapted, including appropriate tissue homogenization, RNA extraction, purification, and DNase treatment methods.

What are the key considerations for developing sensitive and specific antibodies against Chicken MPPE1?

Developing sensitive and specific antibodies against Chicken MPPE1 requires careful planning and execution across several stages:

  • Antigen design and preparation:

    • Select unique, antigenic epitopes using bioinformatics tools that analyze:

      • Hydrophilicity and surface exposure

      • Sequence uniqueness compared to other chicken proteins

      • Conservation across species if cross-reactivity is desired

    • Consider using:

      • Full-length recombinant protein for polyclonal antibodies

      • Synthetic peptides (15-25 amino acids) for epitope-specific antibodies

      • Recombinant protein fragments for domain-specific recognition

  • Immunization strategy:

    • Select appropriate host species (rabbit, mouse, goat) based on:

      • Amount of antibody needed

      • Applications intended (Western blot, ELISA, immunohistochemistry)

      • Evolutionary distance from chickens for better immunogenicity

    • Design immunization schedule with:

      • Proper adjuvant selection

      • Optimal booster timing

      • Monitoring of antibody titer development

  • Screening and validation:

    • Test antibody specificity using:

      • Western blot against recombinant MPPE1 and chicken tissue lysates

      • ELISA comparing wild-type and MPPE1-depleted samples

      • Immunoprecipitation followed by mass spectrometry

      • Immunohistochemistry with competing peptides as controls

    • Evaluate performance in sandwich ELISA formats:

      • As capture antibody

      • As detection antibody

      • In conjunction with commercial antibodies

  • Optimization for specific applications:

    • For ELISA applications (like the kit described in ):

      • Determine optimal antibody concentration for coating plates

      • Establish blocking conditions to minimize background

      • Optimize detection antibody concentration and incubation conditions

      • Validate with known positive and negative controls

  • Quality control and standardization:

    • Establish lot-to-lot consistency protocols

    • Determine antibody stability under various storage conditions

    • Document specificity across different chicken tissues/cell types

    • Validate absence of cross-reactivity with other metallophosphoesterases

These considerations are particularly important when developing antibodies for sensitive quantitation methods like the sandwich ELISA described in search result , where both capture and detection antibodies must maintain high specificity for accurate results.

How might MPPE1 function contribute to avian disease resistance or susceptibility?

MPPE1's role in GPI-anchor protein processing suggests it may significantly impact avian disease resistance or susceptibility through several mechanisms:

  • Immune receptor functionality:

    • Many immune receptors and complement regulatory proteins are GPI-anchored

    • Proper processing and transport of these molecules are essential for immune surveillance and response

    • Variations in MPPE1 activity could affect cell surface presentation of these immune components

  • Pathogen interaction and entry:

    • Some pathogens target or utilize GPI-anchored proteins for cell entry

    • Altered GPI-anchor processing might modify susceptibility to specific pathogens

    • MPPE1 activity variations could influence membrane microdomain organization where many pathogen interactions occur

  • Signal transduction:

    • GPI-anchored proteins participate in signal transduction pathways

    • MPPE1's role in protein phosphorylation could affect downstream signaling cascades

    • These pathways often regulate immune responses and cellular defense mechanisms

  • Relationship to viral pathogenicity:

    • Search result examines genetic factors affecting chicken survivability during viral infection

    • While not directly discussing MPPE1, the methodologies described for studying gene expression during infection could be applied to investigate MPPE1's role

    • Expression levels of MPPE1 might correlate with survivability outcomes in viral challenges

Research approaches to investigate these connections could include comparing MPPE1 expression and genetic variations between disease-resistant and susceptible chicken lines, analyzing changes in MPPE1 expression during infection, and studying the effects of MPPE1 modulation on pathogen replication and immune responses.

What is the comparative analysis of MPPE1 structure and function across different avian species?

A comparative analysis of MPPE1 structure and function across different avian species would involve:

  • Sequence analysis:

    • Multiple sequence alignment of MPPE1 proteins from diverse avian species

    • Identification of conserved domains, active sites, and metal-binding regions

    • Analysis of selection pressure on different protein regions

    • Phylogenetic analysis to correlate MPPE1 evolution with species divergence

  • Structural comparison:

    • Homology modeling of MPPE1 from different species

    • Comparison of predicted protein folding and active site architecture

    • Analysis of surface charge distribution and potential interaction interfaces

    • Identification of species-specific structural features

  • Functional characterization:

    • Comparative enzymatic activity assays using recombinant MPPE1 from different species

    • Analysis of substrate preferences and kinetic parameters

    • Evaluation of metal ion requirements and pH optima

    • Assessment of inhibitor sensitivity and regulatory mechanisms

  • Expression pattern analysis:

    • Comparison of tissue-specific expression profiles across species

    • Analysis of developmental regulation patterns

    • Evaluation of expression responses to environmental challenges

    • Correlation of expression patterns with species-specific physiological traits

This comparative approach could reveal evolutionary adaptations in MPPE1 function that might relate to species-specific differences in metabolism, immune function, or environmental adaptations. The methodology could build upon the gene annotation approaches described in search result , where chicken gene data were annotated with human orthologs using BLAST.

How does MPPE1 interact with other components of the GPI-anchor processing pathway in avian systems?

Understanding the interactions between MPPE1 and other components of the GPI-anchor processing pathway in avian systems requires investigating several key aspects:

  • Protein-protein interaction network:

    • Co-immunoprecipitation followed by mass spectrometry to identify binding partners

    • Proximity labeling techniques (BioID, APEX) to map spatial relationships

    • Yeast two-hybrid or mammalian two-hybrid screens to detect direct interactions

    • Fluorescence resonance energy transfer (FRET) to validate interactions in live cells

  • Temporal and spatial coordination:

    • Subcellular localization studies using fluorescently tagged proteins

    • Pulse-chase experiments to track the timing of sequential processing steps

    • Live-cell imaging to monitor dynamic interactions during GPI-anchor maturation

    • Correlative light and electron microscopy to precisely locate MPPE1 within the endomembrane system

  • Enzymatic pathway analysis:

    • Reconstitution of the pathway using purified components

    • Analysis of how manipulating MPPE1 affects upstream and downstream processing steps

    • Identification of rate-limiting steps and regulatory checkpoints

    • Metabolic labeling of GPI intermediates to track processing efficiency

  • Comparative analysis with mammalian systems:

    • Investigating avian-specific features of the pathway

    • Cross-species complementation experiments

    • Identifying evolutionary differences in processing requirements

The findings from these investigations would provide valuable insights into the GPI-anchor processing pathway in avian systems, which is critical for understanding the maturation of many important cell surface proteins. This knowledge could potentially be applied to optimize expression systems for recombinant GPI-anchored proteins or to develop strategies for modulating this pathway in research or therapeutic contexts.

What role might MPPE1 play in the development and function of the avian nervous system?

MPPE1's potential role in avian nervous system development and function merits investigation based on several lines of evidence:

  • Neurological implications from mammalian studies:

    • MPPE1 is widely expressed in brain tissue

    • The gene has been associated with bipolar disorder in humans

    • Phosphorylation-dephosphorylation processes are critical for neuronal signaling

  • GPI-anchored proteins in neural development:

    • Many neural cell adhesion molecules are GPI-anchored

    • Axon guidance proteins often utilize GPI anchors

    • Neuronal receptors may require proper GPI processing for function

    • Synaptogenesis involves numerous GPI-anchored proteins

  • Research approaches to investigate MPPE1 in avian neurodevelopment:

    • Temporal and spatial expression analysis during embryonic development

    • In situ hybridization and immunohistochemistry in developing avian brain

    • MPPE1 knockout or knockdown in neural progenitors

    • Electrophysiological assessment of neuronal function following MPPE1 manipulation

    • Analysis of axon growth, guidance, and synaptogenesis in MPPE1-deficient neurons

  • Potential areas of impact:

    • Neuronal migration and positioning

    • Axon pathfinding and target recognition

    • Synapse formation and plasticity

    • Myelination processes

    • Neuronal survival and death decisions

Given the association between MPPE1 variations and neuropsychiatric disorders in humans , understanding its role in avian neural development could provide valuable comparative insights into conserved mechanisms of nervous system development and function across vertebrate species.

What are the most promising approaches for studying MPPE1's role in cellular phosphorylation networks?

Investigating MPPE1's role in cellular phosphorylation networks requires sophisticated approaches that can capture the complexity of phosphorylation-dependent signaling:

  • Phosphoproteomics:

    • Quantitative phosphoproteomic analysis comparing wild-type and MPPE1-deficient cells

    • Temporal profiling of phosphorylation changes following MPPE1 manipulation

    • Enrichment of phosphopeptides using titanium dioxide or immobilized metal affinity chromatography

    • Analysis using high-resolution mass spectrometry and advanced bioinformatics

  • Kinase-phosphatase interaction networks:

    • Identification of kinases affected by MPPE1 activity

    • Mapping of phosphorylation cascades influenced by MPPE1

    • Investigation of potential direct dephosphorylation targets

    • Analysis of competition or cooperation with other phosphatases

  • Signaling pathway reconstruction:

    • Computational modeling of phosphorylation networks

    • Perturbation analysis using specific pathway inhibitors

    • Integration of transcriptomic, proteomic, and phosphoproteomic data

    • Validation using reporter assays for key signaling nodes

  • Advanced microscopy techniques:

    • FRET-based phosphorylation sensors to monitor activity in live cells

    • Single-molecule tracking of phosphorylation events

    • Super-resolution microscopy to visualize phosphorylation microdomains

    • Optogenetic control of MPPE1 activity to study temporal dynamics

This research direction is particularly relevant given that MPPE1 contains metal binding and active sites similar to serine/threonine phosphoprotein phosphatase catalytic subunits, which are involved in various cellular processes including gene expression, cell growth, and cell differentiation . Understanding MPPE1's role in cellular phosphorylation networks could provide insights into its contribution to both normal cellular functions and pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.