Recombinant Chicken Methylsterol monooxygenase 1 (MSMO1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken Methylsterol Monooxygenase 1 (MSMO1)

Recombinant Chicken Methylsterol Monooxygenase 1 (MSMO1) is a protein produced through recombinant DNA technology. It is a full-length protein derived from the chicken gene, expressed in Escherichia coli (E. coli) and tagged with a His-tag for purification and identification purposes . MSMO1, also known as sterol-C4-methyl oxidase (SC4MOL), plays a crucial role in the cholesterol biosynthesis pathway by catalyzing the demethylation of C4-methylsterols .

Characteristics of Recombinant Chicken MSMO1

The recombinant chicken MSMO1 protein is characterized by its full-length sequence of 296 amino acids, with an N-terminal His-tag. It is provided in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE. The protein is stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

CharacteristicsDescription
SpeciesChicken
SourceE. coli
TagHis-tag
Protein LengthFull Length (1-296)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Biological Function of MSMO1

MSMO1 is involved in the cholesterol biosynthesis pathway, specifically in the demethylation of C4-methylsterols. This enzyme is crucial for the progression of cholesterol synthesis, which is essential for various cellular processes, including membrane formation and hormone production .

Research Findings and Applications

While specific research on recombinant chicken MSMO1 is limited, studies on MSMO1 in general highlight its role in cancer progression and drug resistance. In cervical squamous cell carcinoma, high MSMO1 expression is associated with poor prognosis and may serve as a prognostic marker . The recombinant protein could potentially be used in research related to cholesterol metabolism and cancer biology.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To request a particular tag, please specify it in your order; we will prioritize fulfilling such requests.
Synonyms
MSMO1; SC4MOL; RCJMB04_5j19; Methylsterol monooxygenase 1; C-4 methylsterol oxidase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
MSMO1
Target Protein Sequence
MAVNDSVNILNSAYLAVEYIDSFLPDNPLQQPFKNAWNYMLDNYTKFQIATWGSLLVHEA SYFLLCVPGFIFQFIPYMQKYKIQPDKPETWEKQWKCFKTLIFNHFFIQLPLICGTYYFT EYFNIPYEWEEMPRWYVLLAQCFGCAVIEDAWHYFLHRLLHHKRIYKYIHKVHHEFVSPF GMQAEYAHPLETLILGAGFFIGIVVFCNHVVLLWAWVICRLMETIDVHSGYDIPLNPLHL VPFYAGARFHDFHHMNFIGNYASTFTWWDRIFGTDSQFIAYKEKEKKQQLRMKKTN
Uniprot No.

Target Background

Function

Catalyzes the initial step in the removal of the two C-4 methyl groups from 4,4-dimethylzymosterol.

Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.