Recombinant Chicken Muscarinic acetylcholine receptor M3 (CHRM3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chicken Muscarinic Acetylcholine Receptor M3 (CHRM3)

Recombinant Chicken Muscarinic Acetylcholine Receptor M3 (CHRM3) is a laboratory-engineered protein derived from the CHRM3 gene, which encodes a G protein-coupled receptor (GPCR) critical for mediating acetylcholine signaling. This receptor subtype regulates diverse physiological processes, including smooth muscle contraction, glandular secretion, and insulin regulation . In research, recombinant CHRM3 is utilized to study receptor structure-function relationships, drug interactions, and disease mechanisms.

Production and Characterization Methods

Recombinant CHRM3 is produced via heterologous expression in E. coli or mammalian cells (e.g., CHO cells). Key steps include:

Production Workflow

  1. Cloning: CHRM3 cDNA is cloned into expression vectors (e.g., T7-based systems) .

  2. Expression: Transformed E. coli or CHO cells secrete the protein, which is purified via nickel affinity chromatography (His-tag) .

  3. Validation:

    • SDS-PAGE: Confirms molecular weight (~72 kDa) .

    • Ligand Binding: Assayed using antagonists (e.g., quinuclidinyl benzilate, K<sub>d</sub> = 76 pM) .

    • Functional Assays:

      • Inositol Phosphate Release: 3.5-fold increase upon carbamylcholine stimulation .

      • cAMP Modulation: 1.6-fold increase in CHO-CM3 cells .

Functional Roles and Signaling Mechanisms

CHRM3 couples to G<sub>q/11</sub> proteins, activating phospholipase C (PLC), which hydrolyzes phosphatidylinositol 4,5-bisphosphate (PIP<sub>2</sub>) into inositol triphosphate (IP<sub>3</sub>) and diacylglycerol (DAG) . This triggers:

  • Intracellular Calcium Release: Via IP<sub>3</sub>-mediated release from the endoplasmic reticulum .

  • Protein Kinase C (PKC) Activation: DAG recruits PKC to the membrane, modulating cellular responses .

Key Physiological Functions

SystemRole
GastrointestinalRegulates peristalsis and glandular secretion (e.g., pancreatic juice)
EndocrineModulates insulin secretion in pancreatic β-cells
CardiovascularControls heart rate and vasodilation
UrinaryInfluences bladder contraction and detrusor muscle activity

Research Applications and Clinical Relevance

Recombinant CHRM3 enables precise studies of receptor-ligand interactions and disease mechanisms:

Drug Discovery

  • Tiotropium Binding: Structural studies reveal tiotropium’s interaction with the orthosteric pocket, guiding bronchodilator design .

  • Antagonist Screening: High-throughput assays using CHRM3-expressing cells evaluate compounds for asthma or overactive bladder therapies .

Disease Modeling

  • Eagle-Barrett Syndrome: Linked to CHRM3 mutations causing urinary tract abnormalities .

  • Polycystic Kidney Disease: CHRM3 dysregulation implicated in cyst formation .

Diagnostic Tools

Assay TypeApplication
ELISAQuantifies CHRM3 levels in chicken serum/plasma (sensitivity: 0.19 ng/mL)
ImmunohistochemistryLocalizes CHRM3 expression in tissues (e.g., brain, pancreas)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
CHRM3; Muscarinic acetylcholine receptor M3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-639
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MLTHYQLCFQKRSSQNYTVPDPTSCFDVPPWTILCQRATMIMHNNSSALPLFSNVSSFWK RDSHGPGLLDEGASLIGSYDSPETTESFPFSTVETTNSSLNATIKDPLGGHAVWQVVLIA FLTGIIALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMG HWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLA WIISFVLWAPAILFWQYFVGKRTVPLDECFIQFLSEPIITFGTAIAAFYLPVTIMSILYW RIYKETEKRTKELAGLQASGSEAETARFVHQTGSSRSLSSYELQRQSTKRSSRRKYRRCH FWLTMKSWEPNTDQGDQEHSSSDSWNNNDAAASLENSASSDEEDITAETRAIYSIVLKLP GHSAILNSTKLPSSEDLNESADELQKSDTDSQEKKPKKLQPPKSIQDGGSFQKSFSKLPI QPGSAETATASDGISSVTKTSAALPLSFKEATLAKKFALKTRSQITKRKRMSLIKEKKAA QTLSAILFAFIITWTPYNIMVLVNTFCDCVPKTVWNLGYWLCYINSTVNPVCYALCNKMF RNTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRIPREAS
Uniprot No.

Target Background

Function

The muscarinic acetylcholine receptor M3 (CHRM3) mediates diverse cellular responses, including inhibition of adenylate cyclase, phosphoinositide breakdown, and modulation of potassium channels via G protein signaling. The primary transduction effect is phosphoinositide turnover.

Database Links

KEGG: gga:396364

STRING: 9031.ENSGALP00000017509

UniGene: Gga.781

Protein Families
G-protein coupled receptor 1 family, Muscarinic acetylcholine receptor subfamily, CHRM3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain, heart atria, and ventricle.

Q&A

What is Chicken Muscarinic Acetylcholine Receptor M3 (CHRM3) and what are its primary functions?

Chicken Muscarinic acetylcholine receptor M3 (CHRM3) is a G protein-coupled receptor that mediates various cellular responses in the chicken nervous system and other tissues. Its primary functions include:

  • Inhibition of adenylate cyclase

  • Breakdown of phosphoinositides

  • Modulation of potassium channels through G proteins

  • Primary transducing effect is phosphoinositide (Pi) turnover

Unlike mammalian hearts which predominantly express the M2 subtype, chicken heart uniquely expresses three muscarinic receptor subtypes: M2, M3, and M4. This makes chicken CHRM3 particularly interesting for comparative studies of cardiac muscarinic signaling .

How does the structure of chicken CHRM3 compare to mammalian CHRM3 variants?

Studies have revealed significant homology between chicken and mammalian CHRM3:

  • The cloned chicken CHRM3 contains an open reading frame coding for a 639 amino acid protein

  • It demonstrates 87% homology to the human M3 muscarinic receptor

  • It demonstrates 86% homology to the rat M3 muscarinic receptor

This high degree of sequence conservation suggests evolutionary importance of this receptor's function across species. Despite the similarities, the unique expression pattern in chicken heart (expressing M2, M3, and M4) differentiates it from mammalian hearts (primarily expressing M2) .

What methods are available for detecting chicken CHRM3 in experimental samples?

Several methods are available for detecting chicken CHRM3:

ELISA-based detection:

  • Commercially available chicken CHRM3 ELISA kits offer high sensitivity and specificity

  • These kits typically detect CHRM3 in serum, plasma, cell culture supernatants, and tissue homogenates

  • Standard deviation is less than 8% for standards repeated 20 times on the same plate

  • Standard deviation is less than 10% when the same sample is measured by different operators

Radioligand binding assays:

  • Quinuclidinly benzilate binding can be used to measure CHRM3 expression

  • Typical binding parameters: Kd of approximately 76 ± 17 pM

RNase protection assays:

  • Effective for demonstrating the presence of M3 muscarinic receptor mRNA in different tissues

  • Successfully used to detect CHRM3 mRNA in brain, atria, and ventricle of chicks 17 days in ovo

What are the common challenges when working with recombinant CHRM3 proteins?

Researchers working with recombinant CHRM3 should be aware of several challenges:

  • Stability concerns: Repeated freezing and thawing is not recommended for recombinant proteins. Working aliquots should be stored at 4°C for up to one week

  • Storage considerations: Liquid form typically has a shelf life of 6 months at -20°C/-80°C, while lyophilized form can be stable for 12 months at -20°C/-80°C

  • Expression systems: The choice of expression system (bacterial, yeast, mammalian) can affect protein folding, post-translational modifications, and functionality

  • Reconstitution protocols: Proper reconstitution is critical for maintaining protein activity and should follow manufacturer's specific instructions

How can researchers differentiate between M3 and other muscarinic receptor subtypes in pharmacological studies?

Distinguishing between muscarinic receptor subtypes requires careful pharmacological characterization:

Antagonist binding profiles for CHRM3:

AntagonistBinding Affinity for M3Comparison to Other Subtypes
HexahydrosiladifenidolHigh affinity (Kd: 16 ± 2 nM)Characteristic for M3 receptors
PirenzepineIntermediate affinity (Kd: 383 ± 47 nM)Helps distinguish from M1
MethoctramineLow affinity (Kd: 533 ± 185 nM)Helps distinguish from M2
4-DAMPHigh affinity (pKi = 9.1)Consistent with M3 and M1 receptors

When performing binding studies, researchers should consider:

  • Using multiple selective antagonists for comparison

  • Implementing a two-site binding model for analysis when appropriate

  • Analyzing displacement binding curves carefully to distinguish receptor populations

The combined pharmacological profile can help definitively identify the M3 subtype from other muscarinic receptors in experimental systems .

What signaling pathways are activated by chicken CHRM3 and how do they differ from mammalian systems?

Chicken CHRM3 activates several signaling pathways that can be experimentally measured:

Primary signaling pathways:

  • Phosphoinositide hydrolysis: M3 receptors couple to PLC with higher efficacy than M2 and M4 receptors

  • Cyclic AMP regulation: Carbamylcholine stimulation of CHO-CM3 cells results in a 1.6-fold increase in cyclic AMP accumulation

  • Inositol phosphate release: Stimulation leads to a 3.5-fold increase in pertussis toxin-insensitive inositol phosphate release

  • Intracellular calcium mobilization: M3 receptors can stimulate a rise in intracellular Ca2+

Unlike mammalian systems where M2 receptors predominantly inhibit adenylyl cyclase, chicken cardiac tissue shows a more complex interplay between M2, M3, and M4 receptors. This creates unique experimental considerations when studying cardiac muscarinic signaling in chicken models .

What experimental approaches are most effective for studying CHRM3-mediated cellular responses in chicken cardiac tissue?

When investigating CHRM3 functions in chicken cardiac tissue, researchers should consider:

Tissue preparation techniques:

  • Fresh isolation of cardiac myocytes from atria and ventricle

  • Careful age selection (studies show CHRM3 expression in chicks 17 days in ovo)

  • Preservation of tissue integrity to maintain receptor expression

Functional assays:

  • Measurement of contractile responses in isolated cardiac tissues

  • Patch-clamp electrophysiology to study ion channel modulation

  • Calcium imaging to detect intracellular calcium changes

  • Biochemical assays for second messenger generation (cAMP, inositol phosphates)

Molecular approaches:

  • RNase protection assays for mRNA detection

  • Receptor binding studies with selective antagonists

  • Immunohistochemistry with specific antibodies (when available)

  • Signal transduction pathway analysis

The unique expression of multiple muscarinic receptor subtypes in chicken heart makes it essential to use selective agonists/antagonists or gene silencing approaches to isolate CHRM3-specific effects from those mediated by M2 and M4 subtypes .

How can recombinant chicken CHRM3 be effectively produced and characterized for research applications?

Based on successful approaches with human CHRM3 and chicken muscarinic receptors, the following methodology is recommended:

Cloning strategy:

  • Use chicken brain cDNA library as a source (previously successful for isolating a 2.4-kilobase pair cDNA)

  • Design primers based on conserved regions of the receptor

  • Amplify the complete coding sequence

  • Verify the open reading frame (expected to code for approximately 639 amino acids)

Expression systems:

  • Cell lines: Chinese hamster ovary (CHO) cells have been successfully used for stable transfection

  • Vector selection: Choose vectors with strong promoters appropriate for the host cell

  • Selection markers: Include appropriate selection markers for stable transfection

  • Tags: Consider adding epitope tags (His, FLAG) for purification and detection

Protein characterization:

  • Confirm expression by Western blotting

  • Verify binding properties using radioligand binding (typical binding parameters: Kd of approximately 76 pM for quinuclidinly benzilate)

  • Assess functional coupling by measuring second messenger responses (cAMP, inositol phosphates)

  • Determine antagonist binding profiles to confirm receptor identity

Proper folding and membrane insertion of the recombinant receptor are critical for maintaining functionality in experimental systems .

What are the critical considerations for designing ELISA-based detection methods for chicken CHRM3?

When designing or optimizing ELISA-based detection methods for chicken CHRM3, researchers should consider:

Assay specificity:

  • Ensure no significant cross-reactivity with other chicken muscarinic receptor subtypes (M2, M4)

  • Validate antibody specificity against recombinant standards

  • Test for potential interference from sample matrix components

Performance parameters:

  • Typical intra-assay precision (CV): <10%

  • Typical inter-assay precision (CV): <10%

  • Expected sensitivity: approximately 0.19 ng/ml

  • Typical test range: 0.312 ng/ml - 20 ng/ml

Sample preparation:

  • Optimize protocols for different sample types (serum, plasma, tissue homogenates)

  • Consider the need for protein extraction buffers containing protease inhibitors

  • Establish consistent homogenization procedures for tissue samples

Validation requirements:

  • Standard curve linearity (r² > 0.99)

  • Recovery experiments with spiked samples

  • Reproducibility testing across operators and days

  • Stability testing of critical reagents

How do genetic modifications of CHRM3 contribute to understanding its physiological role in chickens?

Genetic approaches offer powerful tools for investigating CHRM3 function:

Gene knockdown/knockout strategies:

  • RNA interference (siRNA, shRNA) for transient knockdown studies

  • CRISPR/Cas9 for stable genetic modifications

  • Antisense oligonucleotides for targeted mRNA reduction

Expression manipulation:

  • Overexpression studies using viral vectors

  • Creation of chicken embryonic stem cells with modified CHRM3

  • In ovo electroporation for embryonic studies

Reporter systems:

  • Fusion proteins with fluorescent tags for localization studies

  • Luciferase reporter assays for promoter studies (similar to those used for the cm2 promoter)

  • Biosensors for real-time monitoring of receptor activation

Research has shown that the cm2 (M2) muscarinic receptor promoter region can drive expression in chicken heart primary cultures, suggesting similar approaches may be valuable for studying CHRM3 regulation. Cytokines like ciliary neurotrophic factor and leukemia inhibitory factor can influence muscarinic receptor expression, providing potential experimental tools for modulating CHRM3 levels .

The combination of these genetic approaches with pharmacological and physiological studies provides a comprehensive understanding of CHRM3's role in chicken physiology, particularly in the unique context of cardiac tissue that expresses multiple muscarinic receptor subtypes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.