Recombinant Chicken NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken NADH-Ubiquinone Oxidoreductase Chain 4L (MT-ND4L)

Recombinant Chicken NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a bioengineered protein corresponding to the mitochondrial-encoded subunit of Complex I (NADH dehydrogenase) in avian species. This 98-amino acid protein plays a critical role in electron transport during oxidative phosphorylation, facilitating the transfer of electrons from NADH to ubiquinone while pumping protons across the mitochondrial inner membrane . Its recombinant form is produced in heterologous systems (e.g., E. coli or yeast) for research, diagnostics, and therapeutic applications.

Gene and Protein Structure

  • Gene Location: Encoded by mitochondrial DNA in chickens (gene ID: 807644) .

  • Protein Dimensions: Full-length polypeptide (1–98 residues) with a molecular weight of ~11 kDa .

  • Key Features:

    • Transmembrane Domains: Forms hydrophobic segments critical for anchoring Complex I in the mitochondrial membrane .

    • Gene Overlap: Shares a 7-nucleotide overlap with MT-ND4 in humans, a feature conserved across species .

Functional Role in Complex I

MT-ND4L is part of the minimal core subunit assembly required for Complex I activity. It contributes to:

  1. Electron Transfer: Stabilizes the prosthetic arm containing FMN and iron-sulfur clusters .

  2. Proton Pumping: Conformational changes during electron transfer drive H⁺ translocation .

  3. Metabolic Regulation: Linked to energy homeostasis and redox balance in mitochondria .

Production Methods

ParameterDetailsSource
Expression SystemE. coli (His-tagged) or yeast (partial sequences)
PurificationNickel-affinity chromatography (His-tag) or SDS-PAGE validation
Purity>90% (SDS-PAGE confirmed)
Storage-20°C/-80°C (lyophilized) or 2–8°C (liquid forms)

Biochemical Properties

PropertyValue/DescriptionSource
Amino Acid SequenceMTLVMFNITIAFTLSLLGLAFHRTHLISALLCLESMMLSMFIPLSIWPVENQTPSFALVPILMLAFSACEAGTGLALMLVASARTHGSDHLHNLNLLQC
Post-Translational ModificationsNone reported (mitochondrially encoded)
StabilitySensitive to repeated freeze-thaw cycles; glycerol recommended for storage

Genetic and Phylogenetic Studies

MT-ND4L has been analyzed in avian mitochondrial genomes to:

  • Resolve Phylogeny: Distinguish Khorasan native chickens from other Asian breeds (e.g., Jiangbian, Red jungle fowl) .

  • Identify Haplotype Diversity: No significant haplotype differences observed in Khorasan populations, suggesting genetic homogeneity .

Diagnostic and Functional Assays

ToolApplicationSource
ELISA KitQuantitative detection of MT-ND4L in chicken serum, plasma, or cell lysates
Recombinant ProteinsFunctional studies (e.g., Complex I reconstitution assays)

Clinical and Metabolic Significance

While MT-ND4L mutations in humans are linked to Leber’s hereditary optic neuropathy (LHON) and metabolic disorders , analogous studies in chickens focus on:

  • Mitochondrial Health: Monitoring oxidative stress and energy metabolism in poultry .

  • Breed Analysis: Utilizing ND4L sequences to trace genetic lineages and preserve native breeds .

Comparative Analysis of Recombinant MT-ND4L Products

VendorExpression SystemTagPurityApplicationsSource
AbbkineN/AN/AN/AELISA-based detection in chicken samples
Creative BiomartE. coliHis>90%Functional studies, SDS-PAGE
MyBioSourceYeastN/APartialPartial protein analysis
CusabioYeastN/A>85%Partial sequence studies

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize the development of your specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MSPLHFSFYSAFTFSSLGLAFHRTHLISALLCLESMMLSMFIPLSIWPVENQTPSFALVP ILMLAFSACEAGTGLAMLVASARTHGSDHLHNLNLLQC
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in chicken mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a 98-amino acid protein encoded by the mitochondrial genome of chickens. It functions as an essential component of the respiratory chain protein complex NADH-COQ, which is responsible for transferring electrons from NADH to the respiratory chain in the mitochondria . As part of Complex I (NADH:ubiquinone oxidoreductase), MT-ND4L contributes to the proton-pumping mechanism that establishes the electrochemical gradient necessary for ATP synthesis.

To study MT-ND4L function:

  • Extract mitochondria from chicken tissue samples

  • Perform blue-native gel electrophoresis (BNGE) to analyze complex I assembly

  • Measure complex I activity using spectrophotometric assays with NADH and artificial electron acceptors

  • Analyze oxygen consumption rates in isolated mitochondria with substrates that enter the electron transport chain through complex I

How conserved is the MT-ND4L gene across chicken breeds?

The MT-ND4L gene shows high conservation across various chicken breeds, particularly among Asian chicken breeds. Comparative genomic analyses of MT-ND4L across chicken breeds reveal minimal genetic distances between closely related populations. For example, studies on Khorasan native chickens showed the lowest genetic distance between their MT-ND4L sequences and those of Jiangbian, Lvenwv, and Red jungle fowl chickens .

Breed ComparisonNucleotide Similarity (%)Genetic Distance
Khorasan - Jiangbian99.50.005
Khorasan - Lvenwv99.50.005
Khorasan - Red jungle fowl99.50.005
Khorasan - Nixi97.80.022
Khorasan - Huaiyang98.30.017

Table 1: Nucleotide similarities and genetic distances of ND4L gene between Khorasan native chickens and other breeds (adapted from phylogenetic analysis data)

What are the most effective methods for cloning and expressing recombinant chicken MT-ND4L?

Recombinant expression of chicken MT-ND4L presents unique challenges due to its hydrophobic nature and mitochondrial origin. The most effective approach involves:

  • Gene Synthesis and Codon Optimization:

    • Synthesize the MT-ND4L gene with codons optimized for the host expression system

    • Include appropriate regulatory elements and purification tags

  • Expression System Selection:

    • Bacterial systems: Use specialized E. coli strains (C41/C43) designed for membrane protein expression

    • Eukaryotic systems: Consider avian cell lines for native-like post-translational modifications

  • Solubilization Strategies:

    • Express with fusion partners that enhance solubility (MBP, SUMO, or thioredoxin)

    • Use mild detergents (DDM, LMNG) for extraction from membranes

  • Purification Protocol:

    • Two-step affinity chromatography followed by size exclusion chromatography

    • Maintain detergent concentration above critical micelle concentration throughout purification

For functional studies, co-expression with other complex I subunits may be necessary to obtain properly folded protein that retains biological activity.

How can researchers effectively introduce specific mutations in chicken MT-ND4L for functional studies?

Introducing targeted mutations in MT-ND4L can be accomplished through several approaches:

  • Base Editing Technology:
    Advanced techniques like DdCBE (DddA-derived cytosine base editors) allow for precise C-to-T conversions in mitochondrial DNA. For example, researchers have successfully changed a coding sequence for Val90 and Gln91 (GTC CAA) in MT-ND4L into Val and STOP (GTT-TAA) by editing specific cytosines . The protocol involves:

    • Design of TALE domains that bind specifically to the target mtDNA sequence

    • Construction of split DddA cytosine deaminase components

    • Optimization of the DddA toxin split orientation (linking 1333C with H-strand binding TALEs works effectively for ND4L)

    • Transfection into avian cells with selection by FACS at 24 hours post-transfection

    • Analysis of editing efficiency by sequencing after 7 days

  • Cell Line Development:

    • Multiple transfection rounds can achieve effectively homoplasmic cells with the desired mutation

    • Sequential cycles of transfection, FACS selection, and recovery periods of 14 days

    • Verification through sequencing and functional assays to confirm phenotypic effects

What is the evolutionary rate of MT-ND4L in chickens and how does it compare to other mitochondrial genes?

The evolutionary rate of MT-ND4L in chickens is higher than previously estimated from fossil calibrations. A detailed study of a 50-generation chicken pedigree identified a non-synonymous mutation in MT-ND4L that allowed researchers to calculate a molecular rate of 3.13 × 10⁻⁷ mutations/site/year (95% confidence interval 3.75 × 10⁻⁸–1.12 × 10⁻⁶) . This rate is substantially higher than traditional estimates based on fossil calibrations.

When comparing MT-ND4L evolution to other mitochondrial genes:

Mitochondrial GeneMutation Rate (mutations/site/year)Type of Mutations Observed
MT-ND4L3.13 × 10⁻⁷Non-synonymous mutation detected in 50-generation study
CYTBSimilar to MT-ND4LSynonymous mutation detected in same study
ND4Lower than MT-ND4LFewer polymorphisms in phylogenetic studies
COILower than MT-ND4LHighly conserved across chicken breeds

Table 2: Comparative mutation rates of mitochondrial genes in chickens (compiled from multiple studies)

How can MT-ND4L sequences be used for phylogenetic analysis of chicken breeds?

MT-ND4L sequences serve as valuable markers for phylogenetic analysis of chicken breeds due to their appropriate level of conservation and variation. The methodology for using MT-ND4L in phylogenetic studies includes:

  • Sample Collection and DNA Extraction:

    • Collect blood samples from diverse chicken populations

    • Extract total DNA using standard protocols (commercial kits such as Thermo DNA extraction kits work effectively)

    • Assess DNA quality through spectrophotometry and agarose gel electrophoresis

  • Amplification and Sequencing:

    • Design primers specific to conserved regions flanking MT-ND4L

    • Optimize PCR conditions (e.g., 94°C for 30s, 54°C for 35s, 72°C for extension)

    • Sequence PCR products using bidirectional Sanger sequencing

  • Sequence Analysis and Tree Construction:

    • Align sequences using MUSCLE or CLUSTAL algorithms

    • Calculate genetic distances using appropriate models (Kimura 2-parameter is commonly used)

    • Construct phylogenetic trees using Maximum Likelihood, Neighbor-Joining, or Bayesian methods

    • Assess node support through bootstrap analysis (1000+ replicates)

The phylogenetic tree based on MT-ND4L can reveal close relationships between breeds like Khorasan native chickens and other Asian breeds including Jiangbian, Lvenwv, and Red jungle fowl, while showing greater distance from breeds like Nixi .

How can MT-ND4L mutations affect mitochondrial function and chicken phenotypes?

MT-ND4L mutations can significantly impact mitochondrial function through several mechanisms:

  • Respiratory Chain Dysfunction:

    • Mutations in MT-ND4L can disrupt complex I assembly and stability

    • This leads to impaired NADH oxidation and reduced electron transfer

    • Consequences include decreased ATP production and increased reactive oxygen species (ROS)

  • Phenotypic Effects:

    • Energy metabolism alterations may affect growth rates and body composition

    • Muscle function can be compromised, affecting meat quality in broilers

    • Potential impacts on heat tolerance and disease resistance

To study these effects experimentally:

  • Compare respiratory chain complex assembly and activity in wildtype vs. mutant tissues

  • Measure mitochondrial membrane potential and ATP production

  • Assess ROS levels and oxidative damage markers

  • Evaluate physiological parameters like growth rate, feed efficiency, and stress responses

What evidence exists for paternal inheritance of MT-ND4L, contradicting the canonical view of strict maternal mtDNA transmission?

The canonical understanding of mitochondrial inheritance in vertebrates has been challenged by evidence of paternal transmission. In a 50-generation chicken pedigree study, researchers identified an instance of paternal inheritance of mtDNA while tracking MT-ND4L and CYTB mutations . This finding contradicts the long-held assumption of strict maternal mitochondrial transmission in vertebrates.

To investigate potential paternal leakage of MT-ND4L:

  • Experimental Design Requirements:

    • Establish breeding pairs with known, distinct MT-ND4L haplotypes

    • Implement strict quality control to prevent sample contamination

    • Use multiple markers to verify authenticity of paternal transmission

  • Detection Methods:

    • High-depth sequencing to detect low-level heteroplasmy

    • Allele-specific PCR to amplify paternal haplotypes

    • Long-range PCR to avoid nuclear pseudogene amplification

    • Single-cell analysis to eliminate tissue mosaicism as an explanation

  • Confirmation Criteria:

    • Demonstration of biparental inheritance across multiple generations

    • Exclusion of contamination through laboratory controls

    • Quantification of paternal contribution to total mtDNA pool

This evidence suggests that paternal leakage of mtDNA may occur more frequently than previously thought, which has significant implications for evolutionary studies and disease inheritance models in poultry.

How can gene editing technologies be applied to study MT-ND4L function in chicken mitochondria?

Advanced gene editing technologies have recently been developed to target mitochondrial DNA, enabling new approaches to study MT-ND4L function:

  • DdCBE-Based Mitochondrial Base Editing:
    Recent advances have created the MitoKO system - a library of highly specific DdCBEs (DddA-derived cytosine base editors) capable of introducing precise modifications in mitochondrial genes. For MT-ND4L specifically, researchers have successfully converted a coding sequence for Val90 and Gln91 (GTC CAA) into Val and STOP (GTT-TAA) .

    Methodology:

    • Design TALE domain pairs that bind opposite strands around the target site

    • Optimize DddA toxin split orientation (linking 1333C with H-strand binding TALEs works effectively for ND4L)

    • Achieve homoplasmic mutation through multiple rounds of transfection and selection

    • Verify editing through deep sequencing

  • Functional Characterization of Edited Cells:
    After successful editing, several approaches can assess the functional impact:

    • Blue-native gel electrophoresis (BNGE) to analyze complex assembly

    • Respirometry to measure oxygen consumption with complex I substrates

    • ATP synthesis assays to quantify energy production capacity

    • ROS detection to assess electron leakage

    • Growth and viability assays under various metabolic conditions

  • Complementation Studies:
    To confirm that observed phenotypes are specifically due to MT-ND4L disruption:

    • Introduce wildtype MT-ND4L expression constructs using allotopic expression

    • Create cell fusion hybrids with different mitochondrial backgrounds

    • Generate transmitochondrial cybrid lines to isolate mitochondrial effects

What are the best sequencing approaches for analyzing MT-ND4L mutations and heteroplasmy in chicken samples?

Analyzing MT-ND4L mutations and heteroplasmy requires specialized sequencing approaches:

  • Next-Generation Sequencing (NGS):

    • Ultra-deep sequencing (>1000× coverage) to detect low-level heteroplasmy (>1%)

    • Library preparation methods that minimize PCR bias

    • Bioinformatic pipelines that distinguish true variants from sequencing errors

    Protocol Overview:

    • Extract total DNA from chicken tissue or blood samples

    • Prepare libraries using PCR-free methods when possible

    • Include unique molecular identifiers (UMIs) to track individual molecules

    • Sequence on Illumina platforms for highest accuracy

    • Apply specialized variant callers designed for heteroplasmy detection

  • Digital Droplet PCR (ddPCR):

    • Highly sensitive for quantifying specific known mutations

    • Can detect heteroplasmy levels as low as 0.1%

    • Provides absolute quantification without requiring standard curves

  • Single-cell mtDNA Analysis:

    • Reveals heteroplasmy distribution across individual cells

    • Requires specialized isolation techniques to prevent contamination

    • Uses amplification methods optimized for limited template material

  • Long-read Sequencing:

    • Oxford Nanopore or PacBio platforms for analyzing larger mtDNA regions

    • Enables detection of structural variants and large deletions

    • Allows phasing of multiple variants to determine haplotype structure

When analyzing heteroplasmy in MT-ND4L, it's critical to establish appropriate thresholds for variant calling and to include multiple technical replicates to ensure reproducibility.

How can researchers effectively analyze the impact of MT-ND4L mutations on respiratory chain complex assembly?

To analyze the impact of MT-ND4L mutations on respiratory chain complex assembly:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):
    This technique allows the separation of intact membrane protein complexes while preserving their native structure and is ideal for assessing complex I assembly:

    • Isolate mitochondria using differential centrifugation

    • Solubilize membranes with mild detergents (digitonin works well for complex I)

    • Separate complexes on gradient polyacrylamide gels (3-12% or 4-16%)

    • Detect complexes by Coomassie staining or in-gel activity assays

    • Western blotting with subunit-specific antibodies can identify assembly intermediates

  • Proteomics Approaches:

    • Combine BN-PAGE with mass spectrometry for detailed subunit composition analysis

    • Quantitative proteomics to compare subunit stoichiometry in mutant vs. wildtype

    • Crosslinking mass spectrometry to identify altered subunit interactions

  • Spectrophotometric Enzyme Assays:

    • Measure NADH:ubiquinone oxidoreductase activity in isolated mitochondria

    • Compare activities across different tissues and developmental stages

    • Determine kinetic parameters (Km, Vmax) to assess subtle functional changes

  • Super-resolution Microscopy:

    • Visualize complex I distribution within mitochondria

    • Track dynamic assembly processes in live cells

    • Quantify co-localization with other respiratory complexes to assess supercomplex formation

These approaches have revealed that disruption of MT-ND4L typically leads to severe assembly defects in complex I, with accumulation of subcomplexes lacking the membrane arm, where ND4L is located .

What are the major technical challenges in working with recombinant MT-ND4L and how can they be overcome?

Working with recombinant MT-ND4L presents several technical challenges:

  • Hydrophobicity and Membrane Integration:
    MT-ND4L is highly hydrophobic with multiple transmembrane domains, making it difficult to express and maintain in soluble form.

    Solutions:

    • Use specialized expression systems designed for membrane proteins

    • Incorporate solubility-enhancing fusion partners

    • Optimize detergent screening for extraction and purification

    • Consider cell-free expression systems with lipid nanodiscs

  • Proper Folding and Assembly:
    MT-ND4L requires interaction with other complex I subunits for proper folding.

    Solutions:

    • Co-express with interacting partners

    • Use mild solubilization conditions to maintain protein-protein interactions

    • Incorporate nanolipid discs to mimic native membrane environment

    • Develop reconstitution protocols with purified complex I components

  • Functional Characterization:
    Assessing the function of isolated MT-ND4L is challenging without the context of intact complex I.

    Solutions:

    • Develop minimalist systems with essential interacting partners

    • Establish complementation assays in MT-ND4L-deficient models

    • Utilize proteoliposomes for functional reconstitution

    • Apply advanced biophysical techniques (EPR, FRET) to study electron transfer

  • Heterologous Expression Efficiency:
    Traditional expression systems often yield low amounts of functional protein.

    Solutions:

    • Optimize codon usage for the host expression system

    • Use stronger promoters with inducible expression

    • Implement chaperone co-expression strategies

    • Consider avian cell expression systems for native-like processing

What are the promising future research directions for studying MT-ND4L in poultry science?

Several promising research directions for MT-ND4L in poultry science warrant exploration:

  • Genetic Diversity and Breed Improvement:

    • Comprehensive analysis of MT-ND4L variation across global chicken populations

    • Association studies linking MT-ND4L variants to traits like metabolic efficiency and heat tolerance

    • Integration of MT-ND4L data into breeding programs for improved mitochondrial function

  • Precision Mitochondrial Editing:

    • Further development of base editing technologies for introducing specific MT-ND4L variants

    • Creation of isogenic chicken lines differing only in MT-ND4L sequence

    • Investigation of heteroplasmy threshold effects on phenotype

  • Mitochondrial-Nuclear Interactions:

    • Study of compatibility between MT-ND4L variants and nuclear-encoded complex I subunits

    • Investigation of compensatory nuclear mutations in response to MT-ND4L variants

    • Development of models to predict optimal mitochondrial-nuclear combinations

  • Environmental Adaptation Mechanisms:

    • Analysis of MT-ND4L function under various environmental stressors (temperature, altitude)

    • Investigation of MT-ND4L role in breed-specific adaptations to diverse environments

    • Exploration of MT-ND4L contributions to disease resistance phenotypes

  • Mitochondrial Inheritance Patterns:

    • Further investigation of the frequency and mechanisms of paternal MT-ND4L transmission

    • Development of methods to track heteroplasmy dynamics across generations

    • Exploration of potential selective advantages of biparental inheritance

By pursuing these research directions, scientists can gain deeper insights into the role of MT-ND4L in chicken biology, evolution, and agricultural applications while addressing fundamental questions about mitochondrial genetics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.