Recombinant Chicken Neuronal acetylcholine receptor subunit beta-2 (CHRNB2)

Shipped with Ice Packs
In Stock

Description

Introduction to Chicken Neuronal Acetylcholine Receptor Subunit Beta-2

The Neuronal acetylcholine receptor subunit beta-2 (CHRNB2) is an essential component of nicotinic acetylcholine receptors (nAChRs) in the chicken nervous system. CHRNB2, also known as "Neuronal acetylcholine receptor non-alpha-1 chain" or "N-alpha 1," represents one of the critical subunits that form functional pentameric nicotinic receptors . These receptors belong to the ligand-gated ion channel family and play fundamental roles in fast synaptic transmission throughout the vertebrate nervous system. The chicken CHRNB2 protein has been extensively studied as a model for understanding neuronal acetylcholine receptor function across species.

The beta-2 subunit contributes significantly to the structural integrity and functional properties of nicotinic receptors. Unlike muscarinic acetylcholine receptors that signal through G-protein coupled mechanisms, nicotinic receptors containing the beta-2 subunit form direct ion channels that, upon binding acetylcholine, undergo conformational changes leading to the opening of sodium-permeable pores . This rapid ionotropic signaling mechanism is crucial for neuronal communication in both central and peripheral nervous systems.

Research into recombinant forms of chicken CHRNB2 has advanced our understanding of receptor pharmacology, subunit assembly, and evolutionary conservation of cholinergic signaling mechanisms across vertebrate species. The availability of recombinant CHRNB2 has enabled detailed structural and functional studies that would otherwise be challenging with native receptor preparations.

Protein Classification and Family

Chicken CHRNB2 belongs to the ligand-gated ion channel (TC 1.A.9) family, specifically within the acetylcholine receptor (TC 1.A.9.1) subfamily . Within this classification, it falls under the Beta-2/CHRNB2 sub-subfamily, highlighting its distinct structural and functional properties compared to other acetylcholine receptor subunits. This classification reflects evolutionary relationships and shared structural features among ion channel proteins.

The beta-2 subunit functions as a non-alpha component within the pentameric structure of nicotinic acetylcholine receptors. These receptors typically comprise combinations of alpha and beta subunits arranged around a central ion-conducting pore. The specific subunit composition determines the receptor's pharmacological properties, ion selectivity, and physiological roles in different neuronal populations.

Acetylcholine Binding and Channel Activation

The beta-2 subunit contributes to the formation of functional nicotinic acetylcholine receptors, which respond to the neurotransmitter acetylcholine. Upon acetylcholine binding, these receptors undergo extensive conformational changes affecting all constituent subunits, including the beta-2 subunit . This coordinated structural rearrangement leads to the opening of an ion-conducting channel across the plasma membrane.

The opened channel is permeable primarily to sodium ions, allowing rapid influx that depolarizes the neuronal membrane . This depolarization can trigger action potentials and subsequent neurotransmitter release at synaptic terminals. The rapid kinetics of nicotinic receptor activation contributes to their essential role in fast synaptic transmission throughout the nervous system.

The beta-2 subunit specifically influences the receptor's pharmacological properties, including sensitivity to agonists and antagonists. Furthermore, it affects channel kinetics, particularly the rate of desensitization following prolonged agonist exposure. These properties make CHRNB2-containing receptors crucial for various cognitive functions, including attention, learning, and memory processes.

Physiological Roles in Neural Circuits

Nicotinic receptors containing the beta-2 subunit are widely distributed throughout the avian central and peripheral nervous systems. In the brain, these receptors modulate the release of various neurotransmitters, including dopamine, glutamate, and GABA. This modulatory function positions CHRNB2-containing receptors as key regulators of neural circuit activity and behavior.

Studies using transgenic approaches have demonstrated that regulatory mechanisms governing CHRNB2 expression are conserved between birds and mammals, suggesting fundamental evolutionary preservation of cholinergic signaling systems . This conservation extends to the neuron-specific expression patterns observed across vertebrate species, highlighting the importance of precise regulation of nicotinic receptor subunits in neural development and function.

Expression Systems and Purification

Recombinant chicken CHRNB2 is typically produced using bacterial expression systems, particularly E. coli . The expression construct includes the coding sequence for amino acids 19-491 of the mature protein, often with an N-terminal polyhistidine (His) tag to facilitate purification. This expression strategy yields full-length protein that can be purified to high homogeneity (>90%) as determined by SDS-PAGE analysis.

The purification process generally involves:

  1. Bacterial cell lysis to release expressed protein

  2. Immobilized metal affinity chromatography (IMAC) using the His tag

  3. Additional chromatographic steps to achieve high purity

  4. Final formulation in a stabilizing buffer containing 6% trehalose at pH 8.0

The resulting protein is typically provided as a lyophilized powder, which enhances stability during shipping and storage. This recombinant production method offers advantages over isolation from native tissues, including higher purity, batch consistency, and the ability to introduce specific modifications or tags.

Quality Control and Validation

Quality control measures for recombinant chicken CHRNB2 typically include:

  1. SDS-PAGE analysis to confirm protein size and purity

  2. Mass spectrometry to verify sequence integrity

  3. Western blotting with specific antibodies

  4. Functional assays when applicable

These quality control procedures ensure that the recombinant protein meets specifications and is suitable for intended research applications. The high purity (>90%) achieved through optimized expression and purification protocols minimizes interference from contaminants in downstream applications .

Comparative Neuroscience and Evolution

Chicken CHRNB2 provides an important comparative model for understanding the evolution of cholinergic systems across vertebrate species. Research has demonstrated remarkable conservation of regulatory mechanisms governing neuronal-specific expression between birds and mammals . This conservation supports the use of chicken nicotinic receptor subunits as models for understanding fundamental aspects of receptor biology with relevance to mammalian systems, including humans.

Transgenic studies incorporating chicken neuronal acetylcholine receptor genes into mammalian systems have revealed that the regulatory elements controlling expression patterns are functionally conserved . This finding highlights the deep evolutionary roots of cholinergic signaling mechanisms and validates cross-species approaches to studying nicotinic receptor function.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please specify them in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
CHRNB2; Neuronal acetylcholine receptor subunit beta-2; Neuronal acetylcholine receptor non-alpha-1 chain; N-alpha 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-491
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
CHRNB2
Target Protein Sequence
TDTEERLVEYLLDPTRYNKLIRPATNGSQLVTVQLMVSLAQLISVHEREQIMTTNVWLTQ EWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVISYDGSIFW LPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI VALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCILITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS PTTHTMPPWVRTLFLRKLPALLFMKQPQQNCARQRLRQRRQTQERAAAATLFLRAGARAC ACYANPGAAKAEGLNGYRERQGQGPDPPAPCGCGLEEAVEGVRFIADHMRSEDDDQSVSE DWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPLFQNYATNSLLQLGQGTPTSK
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change affecting all subunits, leading to the opening of an ion-conducting channel across the plasma membrane.
Database Links

KEGG: gga:395605

STRING: 9031.ENSGALP00000004261

UniGene: Gga.336

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-2/CHRNB2 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of chicken CHRNB2 protein?

Chicken neuronal acetylcholine receptor subunit beta-2 (CHRNB2) is a membrane protein that functions as part of pentameric ligand-gated ion channels. The full-length mature protein spans amino acids 19-491 and contains a signal peptide and four transmembrane domains . The amino acid sequence includes critical regions for acetylcholine binding and channel formation. The recombinant protein typically includes an N-terminal His tag when produced for research purposes, while maintaining the full sequence of the mature protein (19-491aa) . The protein contains multiple functional domains including ligand binding sites and pore-forming regions that are essential for its role in neurotransmission.

What are the primary functions of CHRNB2 in neural systems?

CHRNB2 serves as a critical component of neuronal nicotinic acetylcholine receptors (nAChRs), primarily forming heteropentameric receptors with alpha subunits (particularly α4) . These receptors:

  • Mediate fast synaptic transmission in the central and peripheral nervous systems

  • Regulate calcium and sodium ion flow across neuronal membranes in response to acetylcholine and nicotine binding

  • Influence various neurological processes including addiction, cognition, and sensory processing

  • Play roles in retinal development and visual system neural patterning

  • Contribute to cholinergic signaling pathways essential for normal brain function

Research has demonstrated that CHRNB2 is particularly important in nicotine response pathways, with genetic variants associated with reduced smoking behavior in humans .

How is CHRNB2 expression regulated in neural tissues?

CHRNB2 expression demonstrates precise spatial and temporal regulation in neural tissues. Studies using transgenic mice carrying the chicken CHRNB2 gene revealed that:

  • Expression is predominantly restricted to the central nervous system

  • Region-specific expression patterns are observed within the brain and spinal cord

  • Most cranial motor nuclei show positive expression

  • The expression pattern overlaps significantly with cholinergic areas in rodents

  • Regulatory mechanisms governing neuron-specific gene expression appear conserved between birds and mammals

This conservation of regulatory elements suggests fundamental mechanisms controlling CHRNB2 expression have been maintained through evolution, making the chicken CHRNB2 a valuable model for understanding human neuronal receptor expression.

What are the optimal conditions for reconstitution and storage of recombinant CHRNB2 protein?

For optimal handling of recombinant chicken CHRNB2:

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is standard)

    • Aliquot for long-term storage

  • Storage recommendations:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Store reconstituted aliquots at -20°C/-80°C for long-term storage

    • Working aliquots can be maintained at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they compromise protein integrity

These conditions maintain protein stability and functional properties for experimental applications.

How can researchers effectively use CHRNB2 in electrophysiological studies?

For optimal electrophysiological characterization of CHRNB2-containing receptors:

  • Expression systems:

    • Heterologous expression in Xenopus oocytes or mammalian cell lines (HEK293, SH-SY5Y)

    • Co-expression with appropriate alpha subunits (typically α4) to form functional receptors

  • Recording techniques:

    • Whole-cell patch-clamp for macroscopic current recordings

    • Single-channel recordings for detailed kinetic analysis

    • Two-electrode voltage clamp for oocyte recordings

  • Experimental considerations:

    • Rapid agonist application systems are essential due to fast desensitization kinetics

    • Low concentrations of agonists (acetylcholine or nicotine) should be used initially (1-10 μM)

    • Control experiments with specific antagonists (e.g., dihydro-β-erythroidine) confirm receptor identity

    • Temperature control is critical as channel kinetics are temperature-dependent

Correlating electrophysiological findings with structural data from recombinant CHRNB2 provides comprehensive insights into channel function and modulation.

How do genetic variants in CHRNB2 influence nicotine addiction pathways?

Genetic studies have revealed important insights into CHRNB2's role in nicotine addiction:

  • Human genetic evidence:

    • Rare loss-of-function and deleterious missense variants in CHRNB2 are associated with 35% decreased odds for heavy smoking (OR = 0.65, CI = 0.56–0.76, P = 1.9 × 10^-8)

    • Common variant rs2072659 shows protective effects against heavy smoking (OR = 0.96; CI = 0.94–0.98; P = 5.3 × 10^-6)

    • These findings suggest an allelic series affecting nicotine response

  • Functional mechanisms:

    • β2 subunit loss abolishes nicotine-mediated neuronal responses

    • CHRNB2 variants attenuate nicotine self-administration behaviors

    • Polymorphism rs2072658 upstream of CHRNB2 modulates initial subjective responses to both nicotine and alcohol

These findings align with experimental observations in knockout mouse models and suggest CHRNB2 as a potential target for smoking cessation therapies, with genetic variants providing natural models for understanding modulation of addiction pathways.

What are the implications of CHRNB2 in cross-species neurodevelopmental studies?

Cross-species studies of CHRNB2 reveal important evolutionary and developmental insights:

  • Conservation patterns:

    • Regulatory mechanisms controlling neuron-specific expression appear conserved between birds and mammals

    • Expression patterns in transgenic mice carrying chicken CHRNB2 show neuronal specificity similar to endogenous expression

  • Developmental roles:

    • CHRNB2 knockout mice display abnormal retinal waves and dispersed retinal ganglion cell projections to dorsal lateral geniculate nuclei

    • Transcriptomic analysis of CHRNB2-deficient mice reveals altered expression of genes involved in:

      • Cell adhesion (particularly cadherin 1)

      • Calcium signaling pathways

      • Cell membrane components

      • Extracellular matrix proteins

  • Research applications:

    • Transgenic models expressing chicken CHRNB2 in mice provide tools to study conserved cholinergic mechanisms

    • Comparative studies help distinguish species-specific versus conserved functions

These cross-species approaches offer unique perspectives on fundamental neurodevelopmental processes regulated by nicotinic receptors.

What methodological approaches optimize CHRNB2 protein production in E. coli systems?

Optimizing recombinant CHRNB2 expression in E. coli requires addressing several challenges:

  • Expression optimization:

    • Use specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Employ low temperatures (16-20°C) during induction to minimize inclusion body formation

    • Consider using fusion partners (e.g., MBP, SUMO) to enhance solubility

    • Optimize induction conditions (IPTG concentration: 0.1-0.5 mM; induction time: 4-16 hours)

  • Purification strategies:

    • Two-step purification using immobilized metal affinity chromatography followed by size exclusion chromatography

    • Include detergents appropriate for membrane proteins (e.g., DDM, LDAO) in all buffers

    • Maintain glycerol (10-20%) in buffers to enhance stability

  • Quality control:

    • Verify protein purity via SDS-PAGE (>90% purity is standard)

    • Confirm identity using Western blotting with anti-His and anti-CHRNB2 antibodies

    • Assess structural integrity using circular dichroism or limited proteolysis

These approaches address the inherent challenges of producing membrane proteins like CHRNB2 in bacterial systems while maintaining structural integrity.

How can researchers effectively analyze CHRNB2-mediated signaling in neuronal systems?

For comprehensive analysis of CHRNB2-mediated signaling:

  • Calcium imaging approaches:

    • Use fluorescent calcium indicators (Fluo-4, Fura-2) to measure receptor-mediated calcium influx

    • Employ both population-based plate reader assays and single-cell imaging

    • Quantify response kinetics, amplitude, and desensitization properties

  • Transcriptomic analysis:

    • Compare gene expression profiles in wild-type versus CHRNB2-deficient models

    • Focus on downstream pathways affected by receptor signaling:

      • Cell adhesion molecules (e.g., cadherin 1)

      • Calcium-dependent signaling components

      • Neuronal development regulators (e.g., Crb1, Ccl21)

  • Functional readouts:

    • Measure neurite outgrowth and synaptogenesis in neuronal cultures

    • Assess changes in nicotine-induced behaviors in animal models

    • Quantify effects on circuit formation using electrophysiological recording

These multi-modal approaches provide complementary insights into CHRNB2 signaling from molecular to systems levels.

How do chicken and mammalian CHRNB2 proteins differ in structure and function?

Comparative analysis reveals both conservation and divergence between avian and mammalian CHRNB2:

FeatureChicken CHRNB2Mammalian CHRNB2Functional Significance
Protein Length473 amino acids (19-491) 475-477 amino acidsMinor structural differences in extracellular domain
Key Binding DomainsConserved cysteine loop and binding pocketConserved cysteine loop and binding pocketSimilar ligand recognition properties
Transmembrane DomainsFour conserved transmembrane domainsFour conserved transmembrane domainsPreserved channel-forming capacity
Expression PatternNeuronal-specific with regional restrictionsNeuronal-specific with similar regional patternsConserved regulatory mechanisms
Receptor AssemblyForms functional receptors with α subunitsForms functional receptors with α subunitsConserved pentameric assembly
Functional PropertiesFast channel opening and desensitizationFast channel opening and desensitizationSimilar electrophysiological properties

These comparisons highlight the evolutionary conservation of essential functional domains while revealing species-specific adaptations that may influence pharmacological responses and regulatory mechanisms.

What insights do mouse knockout models provide about CHRNB2 function?

Studies of CHRNB2 knockout mice have revealed critical insights into its functional roles:

  • Neurodevelopmental phenotypes:

    • Abnormal retinal waves during development

    • Dispersed projections of retinal ganglion cells to dorsal lateral geniculate nuclei

    • Altered expression of cell adhesion molecules, particularly cadherin 1

  • Transcriptomic changes:

    • Reduced expression of genes located on cell membranes or in extracellular space

    • Decreased expression of genes involved in cell adhesion and calcium signaling

    • In retinal tissue, increased expression of Crb1 and Ccl21, genes associated with retinal neuronal degeneration

  • Behavioral phenotypes:

    • Reduced sensitivity to nicotine

    • Altered nicotine self-administration behavior

    • Changes in initial responses to both nicotine and alcohol

  • Genetic background effects:

    • Comparison of different CHRNB2 knockout strains reveals the influence of genetic background on gene expression profiles

    • This genetic context dependence highlights the importance of considering strain differences in experimental design

These knockout models provide valuable systems for understanding CHRNB2's roles in development, addiction, and neural circuit formation.

What emerging technologies are advancing CHRNB2 research?

Several cutting-edge approaches are transforming CHRNB2 research:

  • Structural biology advances:

    • Cryo-electron microscopy for high-resolution structures of intact nicotinic receptors

    • Molecular dynamics simulations to understand conformational changes during channel gating

    • Structure-based drug design targeting specific CHRNB2-containing receptor subtypes

  • Genetic engineering approaches:

    • CRISPR/Cas9-mediated gene editing to introduce specific CHRNB2 variants

    • Conditional and cell-type-specific knockout models for refined functional analysis

    • Humanized mouse models expressing human CHRNB2 variants associated with addiction or epilepsy

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize receptor clustering and trafficking

    • Genetically encoded voltage indicators for real-time activity mapping

    • Optogenetic manipulation of CHRNB2-expressing neurons

These technologies promise to advance our understanding of CHRNB2 from molecular to systems levels, with implications for both basic neuroscience and therapeutic development.

How might CHRNB2 research inform therapeutic strategies for nicotine addiction?

Translational applications of CHRNB2 research for nicotine addiction include:

  • Genetic insights for therapeutic development:

    • Protective genetic variants in CHRNB2 provide natural blueprints for drug design

    • Allelic series suggests multiple mechanisms for modulating receptor function

    • Integration of human genetic data with functional studies accelerates target validation

  • Potential therapeutic approaches:

    • Subtype-selective negative allosteric modulators of α4β2 receptors

    • Partial agonists with reduced addiction liability

    • mRNA-based therapies to modulate CHRNB2 expression levels

  • Precision medicine applications:

    • Genetic screening for CHRNB2 variants to predict treatment responses

    • Personalized dosing strategies based on receptor genetics

    • Combined genetic and pharmacological approaches

These research directions highlight the potential for CHRNB2-focused strategies to advance beyond current smoking cessation therapeutics toward more effective, targeted interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.