Recombinant Chicken Neuronal acetylcholine receptor subunit beta-4 (CHRNB4)

Shipped with Ice Packs
In Stock

Description

Introduction

CHRNB4 is a subunit of neuronal nAChRs, ligand-gated ion channels mediating synaptic transmission. Recombinant Chicken CHRNB4 is produced via heterologous expression systems to study its role in receptor assembly, ion channel dynamics, and ligand interactions. Its homology across species makes it a valuable model for comparative neuropharmacology .

Expression Systems and Production

Recombinant Chicken CHRNB4 is expressed in multiple systems:

Host SystemPurityApplications
E. coli≥85%Structural studies, antibody production
Baculovirus/Insect Cells≥85%Functional assays, ligand screening
Mammalian Cells≥85%Electrophysiology, receptor trafficking

Higher purity (>90%) is achievable in E. coli for crystallography or NMR .

Functional Properties

CHRNB4 combines with α subunits (e.g., α3) to form functional heteromeric nAChRs:

  • Ion Conductance: β4-containing receptors exhibit longer open times (1.4–6.5 ms) and higher conductance (31 pS) compared to β2 subunits .

  • Ligand Sensitivity: Binds acetylcholine, nicotine, and cytisine with moderate affinity .

  • Desensitization: Slower desensitization kinetics than β2-containing receptors .

Research Applications

  • Pharmacological Studies: Used to screen nicotinic ligands and toxins (e.g., α-conotoxins) .

  • Disease Models: Linked to nicotine dependence and lung cancer risk in human homologs .

  • Structural Biology: Facilitates cryo-EM and X-ray crystallography of nAChR pentamers .

Comparative Analysis with Other Species

FeatureChicken CHRNB4Human CHRNB4Rat CHRNB4
Amino Acid Identity~85%100%~92%
Expression HostsE. coli, Insect cellsWheat germ, HEK293E. coli, Mammalian cells
Ligand AffinityModerate for nicotineHigh for epibatidineHigh for cytisine

Homology in TM domains ensures conserved ion channel function, while extracellular loops dictate species-specific ligand interactions .

Key Research Findings

  1. Channel Kinetics: Coexpression with α3 in Xenopus oocytes revealed β4 subunits prolong channel open states, enhancing cation flux .

  2. Genetic Variants: SNPs in CHRNB4 correlate with nicotine addiction in humans, highlighting its role in reward pathways .

  3. Toxin Interactions: β4-containing receptors resist inhibition by κ-bungarotoxin, unlike β2 subtypes .

Table 1: Pharmacological Profile of β4-Containing nAChRs

LigandEC₅₀ (μM)Maximal Response (% of ACh)
Acetylcholine (ACh)50–100100%
Nicotine1–1080–90%
Cytisine0.1–160–70%
Epibatidine0.01–0.1120–150%

Table 2: Electrophysiological Properties

Parameterα3β4 Receptorsα4β4 Receptors
Mean Open Time (ms)6.5 ± 0.85.3 ± 0.7
Single-Channel Conductance (pS)3129
Desensitization τ (s)12.4 ± 1.28.9 ± 0.9

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributor.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of the product depends on several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
CHRNB4; Neuronal acetylcholine receptor subunit beta-4; Neuronal acetylcholine receptor non-alpha-3 chain; N-alpha 3; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
4-470
Protein Length
Full Length of Mature Protein
Species
Gallus gallus (Chicken)
Target Names
CHRNB4
Target Protein Sequence
ADAEEKLMNHLLSPDRYNKLIRPAVNSSQLVSIELQVSLAQLISVNEREQIMTTNVWLNQ EWIDYRLAWKPSDYEGINMLRIPAKHIWLPDIVLYNNADGTYEVSLYTNAIVQNNGSIRW LPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKTSMASMDDFTPSGEWDI VALPGRRTENPLDPNYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRS PSTHTMPPWVKLVFLERLPAYLFMKRPENNSPRQKPANCKKTRAENLCMDPADFYKNSTY FVNTASAKKYDMKITDTLDNVSSHQDFRLRTGTKFSPEVQEAIDGVSFIAEHMKSDDNDQ SVIEDWKYVAMVVDRLFLWIFVLVCVLGTVGLFLQPLFQNHIAATNP
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change that affects all subunits. This change ultimately leads to the opening of an ion-conducting channel across the plasma membrane.
Database Links

STRING: 9031.ENSGALP00000004740

UniGene: Gga.341

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-4/CHRNB4 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of chicken CHRNB4 and how does it compare to mammalian orthologs?

Chicken CHRNB4 (Gallus gallus, UniProt ID: Q7T3Y2) is a subunit of the nicotinic acetylcholine receptor (nAChR) that forms ligand-gated ion channels with a central pore creating a cation channel. The protein contains an extracellular amino terminus and four transmembrane domains, similar to its mammalian counterparts .

The chicken CHRNB4 gene is located on chromosome 15 and encodes a protein that shares approximately 80-85% sequence homology with human CHRNB4. Like human CHRNB4, the chicken ortholog belongs to the ligand-gated ion channel family (TC 1.A.9) and acetylcholine receptor subfamily . The genomic organization has been clarified through recent complete chicken genome sequencing, which has uncovered previously missing chromosome models that contribute to understanding the evolutionary conservation of this gene .

How does chicken CHRNB4 function in neuronal signaling pathways?

Chicken CHRNB4 functions similarly to its mammalian counterparts, primarily forming heteromeric receptors with alpha subunits (particularly α4). Upon binding acetylcholine, the receptor undergoes extensive conformational changes affecting all subunits, leading to the opening of an ion-conducting channel across the plasma membrane .

Electrophysiological studies have demonstrated that chicken α4β2 neuronal nicotinic receptors can be activated via two distinct pathways:

  • The conventional acetylcholine-binding site

  • A secondary site that recognizes compounds like physostigmine and galanthamine as agonists

In outside-out patches excised from transfected mouse fibroblasts expressing chicken α4β2 receptors, agonists such as (+)-anatoxin-a, physostigmine, and galanthamine (at 1 μM concentrations) activate single channels with conductances of 18 and 30 pS . This dual activation mechanism represents an important functional characteristic of chicken nAChRs containing the CHRNB4 subunit.

What expression systems are recommended for recombinant chicken CHRNB4 production?

For optimal expression of functional recombinant chicken CHRNB4, researchers have successfully used several systems:

Expression SystemAdvantagesLimitationsApplications
Mammalian CellsProper post-translational modifications, high functional yieldHigher cost, longer production timeElectrophysiology, structural studies
Wheat Germ Cell-FreeRapid production, good for fragmentsMay lack some post-translational modificationsELISA, Western blot
Mouse Fibroblasts (M10)Stable expression with dexamethasone inductionCell line-specific optimizations neededPatch-clamp studies

The choice depends on your experimental needs. For single-channel recordings and functional studies, mammalian expression systems like M10 mouse fibroblasts have been demonstrated to effectively express functional chicken α4β2 receptors that can be characterized by patch-clamp techniques .

What purification and quality control methods are essential for chicken CHRNB4 research?

Purification of recombinant chicken CHRNB4 typically involves the following steps:

  • Addition of affinity tags (e.g., His-tag) during expression

  • Initial capture using affinity chromatography

  • Further purification via size exclusion chromatography

  • Quality control assessment

For quality control, multiple parameters should be evaluated:

  • Purity: SDS-PAGE analysis with Coomassie staining should demonstrate >80% purity

  • Endotoxin levels: Must be <1.0 EU per μg protein as determined by LAL method

  • Functional activity: Binding assays with known ligands or co-immunoprecipitation with partner subunits

  • Structural integrity: Circular dichroism or thermal shift assays

Storage recommendations include keeping the protein at +4°C for short-term use or at -20°C to -80°C in PBS buffer for long-term storage to maintain stability and functionality .

How can chicken CHRNB4 be used to investigate nicotinic receptor pharmacology?

Chicken CHRNB4-containing receptors serve as valuable research tools for pharmacological investigations due to their distinct binding properties. Research has demonstrated that these receptors possess two separate binding sites:

  • The acetylcholine-binding site: Activated by conventional agonists like (+)-anatoxin-a and blocked by dihydro-β-erythroidine (1-30 nM)

  • A novel binding site: Recognizes compounds like physostigmine and galanthamine as agonists, is unaffected by dihydro-β-erythroidine, but can be blocked by the nicotinic receptor-specific monoclonal antibody FK1

This dual-site model makes chicken CHRNB4 particularly useful for:

  • Screening novel compounds for nicotinic receptor activity

  • Investigating allosteric modulation mechanisms

  • Developing selective agonists/antagonists with potential therapeutic applications

When designing experiments, researchers should consider both binding sites and employ appropriate controls to distinguish between activation mechanisms.

What electrophysiological characteristics differentiate chicken CHRNB4-containing receptors?

The electrophysiological properties of chicken CHRNB4-containing receptors (particularly α4β2) demonstrate distinct features:

  • Single-channel conductances of 18 and 30 pS when activated by 1 μM of (+)-anatoxin-a, physostigmine, or galanthamine

  • Differential response to antagonists depending on the activation pathway:

    • Channels activated by anatoxin (1 μM) show reduced frequency in the presence of dihydro-β-erythroidine (1-30 nM) but are unaffected by FK1 antibody

    • Channels activated by physostigmine (1 μM) are unaffected by dihydro-β-erythroidine but show markedly decreased frequency in the presence of FK1 antibody

These distinctive properties allow researchers to pharmacologically distinguish between different activation mechanisms and potentially identify novel therapeutic targets.

How has CHRNB4 evolved in the chicken genome compared to other species?

Recent complete sequencing of the chicken genome has provided insights into the evolutionary history of CHRNB4. The chicken genome contains several distinctive features relevant to CHRNB4 evolution:

  • Small microchromosomes with unique genomic and epigenetic characteristics unlike any other vertebrate chromosomes, yet stable and conserved in birds

  • Higher-order repeats (HORs) in centromeric regions similar to those found in primates

Evolutionary analysis suggests that CHRNB4 has remained relatively conserved through vertebrate evolution, with key functional domains maintained across species. The complete chicken chromosome models have helped researchers reconstruct the karyotype of vertebrate ancestors and reveal the evolutionary trajectory of chromosome changes .

This evolutionary conservation suggests that findings from chicken CHRNB4 studies can provide valuable insights applicable to understanding nicotinic receptor function across species, including humans.

How can chicken CHRNB4 research inform our understanding of human nicotinic receptors in disease states?

Studies of chicken CHRNB4 provide valuable comparative insights for human health research, particularly regarding:

  • Nicotine dependence: Human CHRNB4 variants have been associated with nicotine dependence . Studies of chicken CHRNB4 can help elucidate conserved mechanisms of receptor modulation by nicotine.

  • Cancer associations: Human CHRNB4 has been identified as a potential prognostic indicator for smoking-related head and neck squamous cell carcinoma (HNSCC) . Research has shown that:

    • CHRNB4 protein expression increases in HNSCC cell lines after long-term treatment with NNK (a tobacco-specific carcinogen)

    • CRISPR/Cas9 gene editing of CHRNB4 in these cell lines allows for functional validation of its role in cancer progression

  • Polymorphism studies: Research on SNPs like rs1948 in CHRNB4's 3'-untranslated region, which has been associated with early age of tobacco initiation in humans, can be complemented by understanding the regulation of chicken CHRNB4 .

Using chicken models allows researchers to investigate evolutionary conserved mechanisms while potentially avoiding some ethical and practical limitations of human studies.

What gene editing approaches are most effective for studying chicken CHRNB4 function?

CRISPR/Cas9 gene editing has been successfully applied to nicotinic receptor subunit genes and represents the most efficient approach for chicken CHRNB4 functional studies. When designing CRISPR/Cas9 experiments for chicken CHRNB4:

  • sgRNA design: Target conserved functional regions such as the acetylcholine binding domain or ion channel pore. Multiple sgRNAs should be tested to identify those with highest editing efficiency.

  • Validation methods:

    • Western blotting to confirm protein reduction

    • Sanger sequencing to verify gene editing

    • Tracking of Indels by Decomposition (TIDE) analysis to quantify editing efficiency

  • Expected outcomes: Successful CRISPR editing of related nicotinic receptor genes has achieved 88-94% editing efficiency, with common editing patterns including single-base insertions (49.5-58.4%) and other editing patterns (21.8-38.9%) .

For functional validation, electrophysiological approaches like patch-clamp recording can assess the impact of CHRNB4 modifications on channel properties.

What are the critical quality control parameters for recombinant chicken CHRNB4 in functional studies?

When using recombinant chicken CHRNB4 for functional studies, several quality control parameters are essential:

ParameterAcceptable RangeValidation MethodSignificance
Purity>80%SDS-PAGE with Coomassie stainingEnsures minimal interference from contaminants
Endotoxin Levels<1.0 EU per μg proteinLAL methodPrevents inflammatory responses in cell-based assays
Protein FoldingNative conformationCircular dichroism, thermal shift assayConfirms biological activity potential
FunctionalitySpecific binding to known ligandsRadioligand binding, ELISAVerifies pharmacological relevance
Co-expressionProper assembly with partner subunitsCo-immunoprecipitationEssential for heteromeric receptor studies

Additionally, when working with chicken α4β2 receptors expressed in heterologous systems, it's important to verify receptor assembly and surface expression through techniques such as immunocytochemistry or biotinylation assays before conducting functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.