Recombinant Chicken Neuropeptide Y receptor type 2 (NPY2R)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics of Recombinant Chicken NPY2R

Recombinant Chicken Neuropeptide Y receptor type 2 (NPY2R) is a synthetic protein engineered to replicate the structure and function of the endogenous chicken NPY2R, a G-protein-coupled receptor (GPCR) involved in neuropeptide signaling. It belongs to the Y-family of receptors activated by neuropeptide Y (NPY) and peptide YY (PYY). This recombinant form is produced via heterologous expression systems, including bacterial, yeast, mammalian cells, or in vitro cell-free methods, with purity typically exceeding 85% as confirmed by SDS-PAGE .

Key Molecular Features

PropertyDetailSource
Gene NameNPY2R
Protein LengthPartial (varies by construct)
Host SystemsE. coli, yeast, mammalian cells, in vitro cell-free systems
Post-Translational TagsHis-tag, Myc-tag, SUMO-tag, Avi-tag, Fc-tag (depending on expression system)
Uniprot IDQ9DDN6

Sequence and Functional Divergence

  • Sequence Identity: ~75–80% with mammalian Y2 receptors but shares a divergent cytoplasmic tail .

  • Ligand Specificity:

    • Mammalian Antagonists: Does not bind BIIE0246 (a Y2-selective antagonist in mammals) .

    • Truncated Peptides: Binds porcine [Leu(31), Pro(34)]NPY with high affinity, unlike mammalian Y2 receptors .

    • Agonist Preference: PYY(3–36) acts as a potent agonist, mirroring its role in satiety regulation .

Signaling Mechanisms

NPY2R couples to Giα proteins, inhibiting adenylate cyclase and reducing cAMP levels. It may also activate phospholipase C (PLC) via Gq or Giβ/γ subunits, initiating downstream pathways like MAPK/ERK phosphorylation .

Production and Purification Protocols

Recombinant NPY2R production involves standardized protocols optimized for host systems:

Host System Comparison

HostExpression PlatformPurification MethodApplicationsSource
E. coliBacterial fermentationAffinity chromatographyStructural studies, binding assays
YeastPichia pastorisSDS-PAGE, HPLCFunctional assays, ligand screening
Mammalian CellsHEK293, CHOImmunoprecipitation, FACSSignaling pathway analysis
In Vitro Cell-FreeWheat germ lysateUltrafiltration, dialysisMembrane protein studies

Tissue Distribution and Physiological Roles

Chicken NPY2R is expressed in central and peripheral tissues, with roles in:

  • Central Nervous System: Hippocampus (similar to mammals) ; regulation of glutamate/GABA release .

  • Peripheral Tissues: Heart, liver, lung, ovary, testes, and duodenum .

Experimental Findings

StudyKey ObservationSource
Ligand-Binding AssaysHigh affinity for porcine [Leu(31), Pro(34)]NPY; low affinity for mammalian Y2 antagonists
Feeding BehaviorY2 agonists (e.g., PYY(3–36)) inhibit feed intake in mammals but not directly tested in chickens
Peripheral SignalingPotential role in adipogenesis, bone metabolism, and energy homeostasis .

Challenges and Future Directions

  • Functional Paradox: Despite structural conservation, chicken NPY2R shows distinct pharmacological profiles, complicating cross-species extrapolation .

  • Therapeutic Potential: Studies on avian NPY2R may inform strategies for metabolic disorders, given its role in peripheral tissues not fully explored in mammals .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; however, additional charges will apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MGPLEAIGEENQTDEMKMELFTKLYLPRYTTPVSELALDPKPELKDSTTLVEVQIILIFA YCSIILLGVIGNSLVIHVIIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLVYTLLGEW KLGPVLCHLVPYAQALAVHVSTVTLTVIALDRHRCIVYHLESKISKRISFLIIGVAWAVS ALLASPLAIFREYSLIEIIPDFKIVVCSEKWPGEGQLNYGTIYSVSMLLIQYVLPLAIIS YAYTRIWTKLKNHVSPGAGNDHYHHRRQKTTKMLVCVVVVFAVSWLPFHAFQLVSDIDSQ VLDLKEYKLIYTVFHVIAMCSTFANPLLYGWMNNNYRTAFLTAFQCEQRLDSIHPEVSAA FKARKKLEAKKSQFPGDSFTQPTNV
Uniprot No.

Target Background

Function

Receptor for neuropeptide Y and peptide YY.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Chicken NPY2R and how does it differ from mammalian Y2 receptors?

Chicken Neuropeptide Y receptor Y2 (NPY2R) is a G protein-coupled receptor that mediates the biological actions of neuropeptide Y (NPY) and peptide YY (PYY) in avian species. It represents the first non-mammalian Y2 receptor to be molecularly cloned and has several distinctive characteristics compared to mammalian orthologs:

  • It displays 75-80% sequence identity to mammalian Y2 receptors

  • It possesses a surprisingly divergent cytoplasmic tail that affects receptor signaling

  • It exhibits substantial pharmacological differences, including non-responsiveness to the mammalian Y2-selective antagonist BIIE0246

  • It shows unexpectedly high affinity for porcine [Leu(31), Pro(34)]NPY, which typically binds poorly to mammalian Y2 receptors

These structural differences highlight important species-specific adaptations in the NPY signaling system while maintaining similar expression patterns in the central nervous system.

What are the key genetic and molecular characteristics of chicken NPY2R?

Chicken NPY2R has several distinctive molecular features important for researchers to consider:

  • Official gene symbol: NPY2R (Gallus gallus)

  • Gene ID: 422405

  • Protein reference sequence: NP_001026299

  • UniProt ID: Q9DDN6

  • Contains novel non-coding exons upstream of the start codon

  • Undergoes alternative mRNA splicing in the 5'-UTR, resulting in multiple transcript variants

  • Expression is controlled by promoter(s) near exon 1 that display promoter activity in DF-1 cells

  • Functionally couples to inhibitory G proteins that suppress cAMP production

Understanding these characteristics is essential for designing appropriate expression constructs and interpreting functional data when working with this receptor.

How is NPY2R distributed in chicken brain and peripheral tissues?

NPY2R shows a distinct expression pattern in chicken tissues that provides clues about its physiological roles:

  • Brain distribution: NPY2R transcripts are detected in various brain regions, with particularly notable expression in the hippocampus

  • The expression pattern in the central nervous system resembles that observed in mammals, suggesting evolutionary conservation of function

  • In male native Thai chickens, NPY-immunoreactive neurons and fibers are extensively distributed throughout the brain, including the paraventricular nucleus (PVN), nucleus infundibuli hypothalami (IN), and other regions

  • NPY2R transcripts are widely expressed in many adult chicken tissues beyond the brain, suggesting diverse physiological roles

To properly investigate NPY2R function, researchers should consider this broad distribution pattern and select appropriate tissue models based on their specific research questions.

What methodologies can be used to detect NPY2R expression in chicken tissues?

Several complementary approaches can be employed to characterize NPY2R expression:

  • RT-PCR: Effective for detecting NPY2R transcript variants across tissues

  • In situ hybridization: Valuable for precise localization of NPY2R mRNA in brain sections

  • Immunohistochemistry: Allows visualization of receptor protein distribution using specific antibodies

  • Promoter activity assays: Dual-luciferase reporter systems can be used to study transcriptional regulation of the NPY2R gene

When designing expression studies, it's important to recognize that NPY2R has multiple transcript variants due to alternative splicing in the 5'-UTR region. Primer design should account for this variation to ensure comprehensive detection of all relevant transcripts.

What are the primary signaling pathways activated by chicken NPY2R?

Chicken NPY2R activates multiple intracellular signaling cascades upon ligand binding:

  • Inhibition of cAMP/PKA pathway: Like mammalian NPY receptors, chicken NPY2R couples to inhibitory G proteins (Gi/Go) that suppress adenylyl cyclase activity and reduce intracellular cAMP levels

  • Activation of MAPK/ERK pathway: NPY2R signaling leads to phosphorylation and activation of extracellular signal-regulated kinases

  • These signaling outcomes can be monitored in heterologous expression systems using cell-based luciferase reporter assays or western blotting for phosphorylated pathway components

Understanding these signaling pathways is crucial for designing functional studies and interpreting receptor activity in different experimental contexts.

How does ligand selectivity differ between chicken NPY2R and mammalian NPY receptors?

Chicken NPY2R exhibits notable pharmacological differences from mammalian orthologs:

LigandChicken NPY2RMammalian NPY2R
cNPY1-36High affinityHigh affinity
cPYY1-37High affinityHigh affinity
cPP1-36Low affinityLow affinity
[Leu(31), Pro(34)]NPYUnexpectedly high affinityLow affinity
BIIE0246 (Y2 antagonist)No bindingSelective antagonist

These pharmacological differences highlight the importance of using species-specific ligands when studying avian NPY receptors. Researchers should not assume that pharmacological tools developed for mammalian systems will maintain their selectivity profiles in avian models.

What expression systems are most effective for studying recombinant chicken NPY2R?

Several expression systems have been successfully used to study chicken NPY2R:

  • HEK293 cells: Effectively express functional chicken NPY2R for pharmacological and signaling studies

  • Mammalian cell lines: Recommended for producing recombinant chicken NPY2R protein with proper post-translational modifications

  • DF-1 cells: Chicken fibroblast cell line useful for studying promoter activity and species-specific aspects of receptor expression

When expressing recombinant chicken NPY2R, consider these technical aspects:

  • Expression tags (e.g., His-tag) can facilitate purification without significantly affecting receptor function

  • Storage in PBS buffer at -20°C to -80°C for long-term storage preserves protein stability

  • Protein purity >80% is typically sufficient for most research applications

What are the most reliable methods for studying chicken NPY2R signaling and function?

Several complementary approaches can be used to investigate NPY2R function:

  • Radioligand binding assays: For characterizing ligand affinity and selectivity profiles

  • Cell-based luciferase reporter systems: To monitor cAMP/PKA pathway inhibition

  • Western blotting: To detect phosphorylation of downstream signaling components like ERK1/2

  • In vivo knockout models: CRISPR/Cas9 system has been used to establish NPY receptor-deficient models in other species and can be applied to chicken NPY2R

When designing functional assays, researchers should carefully select positive and negative controls and be aware of potential cross-talk between different NPY receptor subtypes that may be endogenously expressed in chosen cell lines.

How does chicken NPY2R fit into the evolutionary history of NPY receptors across vertebrates?

Chicken NPY2R provides important evolutionary insights as the first characterized non-mammalian Y2 receptor:

  • NPY receptors are divided into three subfamilies: Y1 (NPY1R, NPY4R, NPY6R, NPY8R), Y2 (NPY2R, NPY7R), and Y5 (NPY5R)

  • Chicken NPY2R belongs to the Y2 subfamily and shows 75-80% sequence identity to mammalian Y2 receptors despite significant evolutionary distance

  • Different NPY receptor gene deletions exist between mammals and teleost fish, suggesting evolutionary divergence in the NPY system across vertebrates

  • The conservation of NPY2R expression patterns in the central nervous system between birds and mammals suggests evolutionarily conserved functions

This evolutionary context helps researchers interpret functional differences between avian and mammalian NPY systems and design appropriate comparative studies.

How do the functional roles of NPY2R compare between avian and mammalian species?

While the complete functional characterization of chicken NPY2R is still evolving, comparison with mammalian systems suggests both similarities and differences:

  • In mammals, NPY receptors regulate feeding behavior, energy balance, anxiety, and circadian rhythms

  • In birds, NPY is similarly involved in food intake regulation and may also play roles in reproductive behaviors

  • In female native Thai chickens, NPY-immunoreactive neurons in the paraventricular nucleus show dynamic changes across reproductive stages, with highest levels during incubating eggs and rearing chicks when the hens naturally fast

  • These observations suggest that while core functions may be conserved, the NPY system may have evolved specialized roles in birds related to their unique reproductive physiology

Understanding these comparative aspects is crucial for translating findings between model systems and interpreting species-specific adaptations.

What are the current challenges in chicken NPY2R functional characterization?

Several key challenges face researchers working with chicken NPY2R:

  • Limited availability of chicken-specific pharmacological tools (agonists/antagonists) necessitates careful validation of reagents developed for mammalian systems

  • The divergent cytoplasmic tail of chicken NPY2R may interact differently with intracellular signaling partners compared to mammalian receptors, requiring specialized assays to fully characterize signaling outcomes

  • Multiple transcript variants arising from alternative splicing in the 5'-UTR complicate expression analysis and may have functional significance that remains to be determined

  • The broad tissue distribution of NPY2R transcripts suggests diverse physiological roles that require tissue-specific investigation approaches

Addressing these challenges requires innovative methodological approaches and careful experimental design.

How can genetic modification approaches be applied to study chicken NPY2R function?

Modern genetic tools offer powerful approaches for investigating NPY2R function:

  • CRISPR/Cas9 system has been successfully used to establish NPY receptor-deficient models in other species like medaka fish

  • In medaka, NPY2R deficiency produced unexpected phenotypes related to sex determination rather than feeding behavior, highlighting the importance of unbiased phenotypic analysis

  • For chicken studies, both in vivo models and cell-based approaches can be valuable:

    • Primary chicken cell cultures with CRISPR-mediated NPY2R knockout

    • Transgenic chicken models with modified NPY2R expression

    • Virus-mediated gene delivery for region-specific manipulation in the chicken brain

When applying these approaches, researchers should carefully consider potential compensatory mechanisms involving other NPY receptor subtypes that may mask phenotypes in knockout models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.