Recombinant Chicken Occludin (OCLN)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken Occludin

The development of recombinant chicken occludin has enabled researchers to study the protein's properties in isolation from other tight junction components, providing clarity about its specific contributions to junction assembly and barrier function. This approach has proven particularly valuable because tight junctions are complex multiprotein structures that are difficult to study in their native environment due to their intricate organization and dynamic properties.

Molecular Structure and Characteristics

Chicken occludin, like its counterparts in other species, is a tetraspanin protein characterized by four transmembrane domains, intracellular N and C termini, and two extracellular loops . The molecular weight of the core protein is approximately 59-65 kDa, though it can exist in various phosphorylated forms that may increase its apparent molecular weight up to approximately 82 kDa . This size variation reflects the protein's dynamic post-translational modification status, which plays an important role in regulating its function.

The four transmembrane domains anchor the protein within the plasma membrane, while the extracellular loops participate in homotypic interactions with occludin molecules on adjacent cells. These interactions contribute to the "sealing" function of tight junctions. The intracellular portions, particularly the C-terminal domain, interact with various cytoplasmic proteins including ZO-1, ZO-2, and ZO-3, which link occludin to the actin cytoskeleton .

Expression and Localization

In natural systems, occludin expression varies significantly depending on tissue type. In brain tissue, occludin is highly and continuously expressed at cell-cell contact sites, whereas non-neural tissues typically show lower expression levels and a more discontinuous distribution pattern . This differential expression correlates with the varying barrier requirements of different tissues, with the blood-brain barrier requiring particularly tight regulation.

When recombinant chicken occludin is overexpressed in experimental systems such as insect cells via baculovirus infection, the protein demonstrates intriguing localization patterns. Most notably, the overexpressed occludin does not predominantly localize to the plasma membrane as might be expected, but instead accumulates in peculiar multilamellar structures within the cytoplasm . These structures represent spontaneously organized membrane formations that appear to mimic aspects of natural tight junctions, suggesting that occludin possesses inherent properties that drive tight junction assembly.

Detailed electron microscopy studies of these structures reveal that each lamella forms from intracellular membranous cisternae whose luminal space becomes completely collapsed. Within these lamellae, the outer leaflets of opposing membranes appear fused with no gaps, resembling the arrangement seen in natural tight junctions . This observation provides compelling evidence that occludin plays a direct role in membrane approximation and fusion events during tight junction formation.

Role in Tight Junction Formation

The ability of recombinant chicken occludin to induce tight junction-like structures when overexpressed provides strong evidence for its central role in tight junction assembly. Although occludin is not absolutely required for tight junction formation, as demonstrated by studies with occludin-null models that still form tight junctions , it appears to be a key regulator of junction properties and barrier function.

When chicken occludin is overexpressed in insect cells, freeze-fracture electron microscopy reveals the presence of short tight junction-like intramembranous particle strands within the multilamellar structures . These strands are specifically labeled by anti-occludin monoclonal antibodies, confirming their composition. The observation that occludin can induce these characteristic tight junction features in a heterologous system lacking other tight junction components strongly suggests that occludin has an intrinsic ability to organize membrane proteins into junction-like arrays.

More recent research has refined our understanding of occludin's role, suggesting that while it may not be essential for the basic assembly of tight junctions, it plays critical roles in regulating barrier properties, including selective permeability and dynamic responses to various stimuli . Recombinant chicken occludin has been instrumental in establishing these nuanced functions by allowing controlled experimental manipulation of occludin levels and properties.

Experimental Findings with Recombinant Chicken Occludin

The experimental expression of recombinant chicken occludin in insect cells has yielded several significant findings that have expanded our understanding of tight junction biology. When overexpressed using recombinant baculovirus infection, chicken occludin induces the formation of distinct multilamellar structures in the cytoplasm of infected cells . Partial isolation and analysis of these structures revealed high enrichment of the introduced chicken occludin, confirming the protein's direct involvement in their formation.

Thin-section electron microscopy provided detailed insights into the ultrastructure of these occludin-induced formations. Each lamella represented a transformed intracellular membranous cisterna with a completely collapsed luminal space. The arrangement of membranes within these structures mimicked the organization seen at tight junctions, with outer leaflets of opposing membranes appearing to be fused with no visible gaps between them .

Further analysis using freeze-fracture electron microscopy occasionally revealed short tight junction-like intramembranous particle strands within these multilamellar structures. These strands were specifically labeled by anti-occludin monoclonal antibodies, confirming that they contained the recombinant chicken occludin . These observations strongly support the hypothesis that occludin plays a key role in organizing membrane proteins into the distinctive strand patterns characteristic of tight junctions.

Table 2: Key Experimental Findings with Recombinant Chicken Occludin

Experimental SystemObservationImplication
Insect cells with baculovirus expressionFormation of multilamellar structuresOccludin can induce membrane reorganization
Thin-section electron microscopyCollapsed luminal spaces with fused membrane leafletsOccludin mediates membrane approximation similar to tight junctions
Freeze-fracture electron microscopyTight junction-like intramembranous particle strandsOccludin contributes to characteristic TJ ultrastructure
ImmunolabelingSpecific labeling of strand structures with anti-occludin antibodiesConfirms occludin's direct incorporation into TJ-like structures

Phosphorylation and Regulation

Post-translational modifications, particularly phosphorylation, play a crucial role in regulating occludin function. Chicken occludin, like occludin from other species, can be phosphorylated on serine and threonine residues . This phosphorylation appears to modulate the protein's localization, stability, and interactions with other tight junction components.

In vitro studies have identified several kinases capable of phosphorylating occludin, including protein kinase CK2 and the p34 cdc2/cyclin B complex . Interestingly, occludin dephosphorylation has been observed during early development in some species, such as Xenopus, where it correlates with de novo assembly of tight junctions in native epithelia . This suggests that the phosphorylation state of occludin may serve as a regulatory switch controlling tight junction assembly and disassembly.

Recombinant chicken occludin has served as a valuable tool for investigating these phosphorylation events. For example, studies using the recombinant cytoplasmic domain of chicken occludin have demonstrated specific phosphorylation by certain kinases on serine and threonine residues . These findings have helped establish the molecular mechanisms underlying the dynamic regulation of tight junction permeability in response to various physiological and pathological stimuli.

Comparison with Occludin from Other Species

Chicken occludin has been particularly valuable for comparative studies because it can be readily expressed in recombinant systems and forms distinctive structures that facilitate analysis. When compared with mammalian occludins, chicken occludin shows similar domain organization but some differences in specific amino acid sequences, particularly in the C-terminal cytoplasmic domain.

Studies in different species have revealed varied roles for occludin. In Xenopus, occludin undergoes developmentally regulated dephosphorylation that correlates with tight junction assembly . In chickens, occludin appears to play important roles in embryonic development, particularly in the formation of epithelial barriers. In mammals, occludin functions in various tissues, with particularly important roles in the blood-brain barrier and intestinal epithelium .

Table 3: Comparison of Occludin Across Species

SpeciesMolecular WeightKey FeaturesNotable Functions
Chicken59-65 kDaForms multilamellar structures when overexpressedKey role in tight junction formation
Xenopus57-61 kDaUndergoes developmental dephosphorylationAssociated with de novo tight junction assembly
Human65 kDa (up to 82 kDa phosphorylated)Mutations cause microcephaly and band-like calcificationsCritical for blood-brain barrier integrity
MouseSimilar to humanKnockout shows postnatal growth retardation and brain calcificationImportant for regulation of TJ but not essential for formation

Research Applications and Future Directions

Recombinant chicken occludin has proven to be an invaluable tool for investigating tight junction biology, with applications spanning basic research to potential therapeutic development. The ability to express and purify this protein has facilitated detailed structural studies, interaction analyses, and functional investigations that would be difficult or impossible with endogenous occludin in complex cellular systems.

One important application has been the use of recombinant chicken occludin to study the fundamental mechanisms of tight junction assembly. By expressing the protein in systems that lack endogenous tight junctions, researchers have been able to isolate occludin's intrinsic properties and contributions to junction formation . This approach has revealed occludin's ability to induce membrane reorganization and tight junction-like structures, providing insights into the molecular processes driving epithelial and endothelial barrier establishment.

Recombinant chicken occludin has also been used as a substrate for studying regulatory mechanisms, particularly phosphorylation. In vitro phosphorylation studies using recombinant chicken occludin have identified specific kinases that modify the protein and potentially regulate its function . These findings have enhanced our understanding of how tight junctions respond dynamically to various physiological and pathological stimuli.

Future research directions may include more detailed structural analyses of recombinant chicken occludin, particularly using advanced techniques like cryo-electron microscopy to elucidate the three-dimensional organization of occludin within tight junction strands. Additionally, comparative studies between chicken occludin and occludin from other species may reveal evolutionary adaptations in tight junction structure and function. The development of modified recombinant chicken occludin variants could also provide tools for manipulating tight junction properties in experimental and potentially therapeutic contexts.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand you may have specific requirements. If so, please indicate your desired format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, ensuring aliquoting for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
OCLN; Occludin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-504
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MFSKKSYDGPPAGYGPPTGYGAPTADYGYGSPPPGSYYVDDAPQLFYKWTSPPGAVRGLQ AGVLVLCIAIFACVASTLAWDYGYGLGGAYGTGLGGFYGSNYYGSGLSYSYGYGGYYGGV NQRTANGFMIAMAVLCFLAQLGLLVAALSKSGATRSRRFYLAVLVLSAVLAFVMLIASIV YIMGVNPQAQMSSGYYYSPLLAMCSQAYGSTYLNQYIYHYCTVDPQEAVAAVCGFLIVIL LCLICFFAQKTRSKIWRYGKANIYWDRAPVVQEGPDVEEWVKNVADGASVQDETATLAYS EKPTSPVAAPPYSYVPPPSAGYYPSGTYSSRGDQPDRALSASPVHGEEEEEKGKDQPSRP PARRGRRRRRNPELDESQYETDYTTAVESSDERDQEQWASLYPPITSDGARQRYKQEFDT DLKRYKQLCAEMDSINDRLNQLSRRLDSITEDSPQYQDVAEEYNQLKDLKRSPDYQSKKQ ESKVLRNKLFHIKRMVSAYDKVRG
Uniprot No.

Target Background

Function
Occludin is thought to play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It interacts with ZO-1, a key component of the TJ complex.
Gene References Into Functions
  1. Studies suggest a connection between feed intake levels and OCLN mRNA expression. This relationship might be direct, with feed intake directly regulating OCLN expression, or indirect, potentially through paracrine or autocrine factors in the ovary. PMID: 28238709
  2. Dietary zinc supplementation appears to mitigate the loss of intestinal mucosal barrier function caused by S. Typhimurium challenge. This protective effect might be related to increased expression of occludin and claudin-1 in broiler chickens. PMID: 22834550
  3. Research has identified a unique motif within the occludin sequence that is involved in regulating ZO-1 binding through reversible phosphorylation of specific tyrosine residues. PMID: 19017651
Database Links

KEGG: gga:396026

UniGene: Gga.603

Protein Families
ELL/occludin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Tissue Specificity
Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in lung and liver. Expressed at a lower level in brain.

Q&A

What is chicken occludin and what role does it play in cellular function?

Chicken occludin is an integral membrane protein that localizes at tight junctions and contains four transmembrane domains. It serves as a key structural and functional component of tight junctions, which are critical for maintaining epithelial and endothelial cell barriers. In chicken tissue, occludin plays an essential role in regulating paracellular permeability and maintaining cell polarity. Studies have demonstrated that occludin is directly involved in the formation of tight junction strands, as evidenced by experiments where chicken occludin overexpression in insect cells resulted in the formation of multilamellar structures that resembled tight junctions . These structures showed collapsed luminal spaces with outer leaflets of opposing membranes appearing fused without gaps, similar to native tight junctions. Freeze-fracture replica analysis revealed tight junction-like intramembranous particle strands that were specifically labeled by anti-occludin monoclonal antibodies, confirming occludin's direct structural role in tight junction formation .

How does recombinant chicken occludin differ structurally and functionally from native occludin?

Recombinant chicken occludin is produced through molecular cloning and protein expression systems rather than being extracted from chicken tissues. While the amino acid sequence remains identical to native occludin, several key differences may exist:

  • Post-translational modifications: Native occludin undergoes phosphorylation and other modifications that affect its function. Recombinant versions may lack these modifications depending on the expression system used.

  • Protein folding: The cellular environment during recombinant expression may result in subtle differences in protein folding compared to the native environment.

  • Purification artifacts: Purification processes may alter protein conformation or remove associated molecules that influence native function.

For research applications requiring maximum functional similarity, eukaryotic expression systems such as insect cells have proven effective for producing recombinant chicken occludin with properties closely resembling the native protein . When chicken occludin was expressed using recombinant baculovirus in insect cells, it formed structures that closely mimicked tight junctions, suggesting proper folding and function of the recombinant protein .

What expression systems are most effective for producing functional recombinant chicken occludin?

The choice of expression system significantly impacts the functionality of recombinant chicken occludin:

Expression SystemAdvantagesLimitationsYieldFunctionality
E. coliHigh yield, cost-effective, simple protocolLacks post-translational modifications, inclusion body formation common5-10 mg/LLimited, requires refolding
Insect cells (Baculovirus)Appropriate post-translational modifications, proper foldingMore complex, higher cost2-5 mg/LHigh, forms tight junction-like structures
Mammalian cellsMost authentic post-translational modificationsHighest cost, complex protocols, lower yield0.5-2 mg/LHighest fidelity to native protein

Research has demonstrated that insect cell expression using baculovirus systems offers an optimal balance between yield and functionality for recombinant chicken occludin. This system has successfully produced recombinant chicken occludin that forms multilamellar structures resembling tight junctions when overexpressed, indicating proper protein folding and functionality .

How can researchers validate the identity and purity of recombinant chicken occludin preparations?

Validation of recombinant chicken occludin requires multiple analytical approaches:

  • SDS-PAGE and Western blotting: Confirm protein size (approximately 59-60 kDa) and immunoreactivity with specific anti-occludin antibodies. Specific monoclonal antibodies can verify the identity of the recombinant protein .

  • Mass spectrometry: Provides definitive identification through peptide mass fingerprinting.

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure to ensure proper protein folding.

  • Size-exclusion chromatography: Evaluates protein homogeneity and detects aggregation.

  • Functional assays: Tests for the ability to incorporate into membranes or interact with known binding partners.

Researchers should achieve >90% purity for most applications, with functional validation through binding assays or membrane incorporation studies to ensure the recombinant protein maintains its native structure and function.

What are the optimal conditions for expressing and purifying recombinant chicken occludin?

The optimal conditions for recombinant chicken occludin expression depend on the chosen expression system. For the recommended baculovirus-insect cell system:

Expression Optimization:

  • Infection MOI (multiplicity of infection): 2-5 for optimal protein expression

  • Harvest timing: 48-72 hours post-infection before significant cell lysis occurs

  • Temperature: 27°C for insect cells

  • Media supplementation: Consider adding protease inhibitors to prevent degradation

Purification Strategy:

  • Cell lysis: Gentle detergent extraction (1% Triton X-100 or n-dodecyl-β-D-maltoside)

  • Initial capture: Immobilized metal affinity chromatography (IMAC) if His-tagged

  • Intermediate purification: Ion exchange chromatography

  • Polishing: Size exclusion chromatography

  • Buffer composition: Typically 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% appropriate detergent

For membrane proteins like occludin, maintaining a detergent concentration above the critical micelle concentration throughout purification is crucial to prevent aggregation. Researchers should validate each batch through SDS-PAGE, Western blotting, and functional assays before experimental use.

How can researchers assess the functional activity of purified recombinant chicken occludin?

Functional assessment of recombinant chicken occludin should evaluate its ability to:

  • Membrane incorporation assays: Using artificial lipid bilayers or liposomes to assess the protein's ability to incorporate into membranes.

  • Protein-protein interaction studies: Evaluating interactions with known binding partners such as ZO-1, claudins, or other tight junction proteins through co-immunoprecipitation, ELISA, or surface plasmon resonance.

  • Electron microscopy analysis: Examining the formation of characteristic multilamellar structures when overexpressed in appropriate cell systems, similar to those observed in baculovirus-infected insect cells .

  • Barrier function restoration: Measuring the ability of recombinant occludin to restore barrier function in occludin-depleted epithelial cell models through transepithelial electrical resistance (TEER) measurements.

  • Phosphorylation status: Evaluating the ability of the recombinant protein to undergo appropriate phosphorylation/dephosphorylation, which is critical for occludin function.

A functional recombinant chicken occludin should demonstrate proper membrane integration, appropriate protein-protein interactions, and the ability to contribute to tight junction formation when introduced into appropriate cellular models.

What experimental models are most appropriate for studying recombinant chicken occludin function?

Several experimental models have proven valuable for studying recombinant chicken occludin function:

Model SystemApplicationsAdvantagesLimitations
Primary chicken intestinal epithelial cellsNative context studies, pathogen responsePhysiologically relevantLimited availability, short lifespan
Chicken cell lines (e.g., LMH, DF-1)Transfection studies, protein localizationEasier to maintain than primary cellsMay not fully recapitulate intestinal barrier function
Insect cells (Sf9, High Five)Protein expression, structural studiesHigh expression, forms tight junction-like structuresNot avian, different membrane composition
MDCK or Caco-2 mammalian cellsCross-species function, barrier studiesWell-characterized tight junction modelsMammalian background
Ex vivo intestinal organ cultureTissue-level studiesMaintains tissue architectureShort viability window

For studies examining the role of chicken occludin in pathogen response or gut barrier function, researchers have successfully used chicken intestinal epithelial cell models challenged with pathogens like Eimeria maxima . These models allow for the assessment of tight junction protein expression and barrier integrity under physiologically relevant conditions.

How can researchers effectively monitor changes in occludin expression and localization?

Researchers have several methodological approaches to monitor occludin expression and localization:

For Expression Quantification:

  • qRT-PCR: Sensitive method for quantifying occludin mRNA expression using primers targeting chicken occludin transcripts .

  • Western blotting: Protein level quantification using specific anti-occludin antibodies. Various commercial antibodies are available with validated reactivity against chicken occludin .

  • ELISA: Quantitative measurement of occludin protein levels in tissue or cell lysates.

For Localization Studies:

  • Immunofluorescence microscopy: Visualizes occludin distribution at tight junctions using fluorescently labeled antibodies.

  • Immunohistochemistry: Examines occludin localization in tissue sections.

  • Subcellular fractionation: Separates membrane-bound from cytoplasmic occludin pools.

  • Freeze-fracture electron microscopy: Reveals the integration of occludin into tight junction strands, as demonstrated in studies with recombinant chicken occludin expressed in insect cells .

When conducting gene expression studies of occludin in chicken intestinal tissue, researchers have successfully used qRT-PCR with primers such as F-AGCCTCAAATGGGATTGGATT and R-CATCAACTTGCATTCGCTTCA with an annealing temperature of 59°C .

How does phosphorylation status affect chicken occludin function in tight junctions?

Phosphorylation is a critical post-translational modification that regulates chicken occludin's functional properties. Research indicates that:

  • Phosphorylation states: Chicken occludin exists in multiple phosphorylation states, with highly phosphorylated forms typically associating with functional tight junctions.

  • Kinases involved: Several kinases phosphorylate occludin, including PKC, CK2, and tyrosine kinases, each affecting different functional aspects.

  • Phosphorylation sites: Multiple serine, threonine, and tyrosine residues in the C-terminal domain are targets for phosphorylation.

  • Functional consequences: Phosphorylation affects:

    • Protein-protein interactions with ZO-1 and other tight junction components

    • Occludin trafficking between cytoplasmic vesicles and the plasma membrane

    • Stability of occludin at the tight junction

    • Barrier regulation during development or stress responses

Studies have investigated occludin dephosphorylation during early developmental stages, suggesting that phosphorylation state transitions play important roles in establishing epithelial barriers during embryonic development . Researchers studying these modifications should consider using phospho-specific antibodies and site-directed mutagenesis approaches to dissect the specific roles of individual phosphorylation sites in chicken occludin function.

What role does chicken occludin play in intestinal barrier function during pathogen challenge?

Chicken occludin plays a critical role in maintaining intestinal barrier integrity during pathogen challenges, as evidenced by several research findings:

  • Expression regulation during infection: Studies have shown that intestinal parasites like Eimeria maxima significantly decrease the expression of tight junction proteins, including occludin, in the chicken jejunum during infection . The downregulation of occludin correlates with increased intestinal permeability and pathology.

  • Inflammatory cytokine interaction: During E. maxima infection, pro-inflammatory cytokines (IL-6, IFN-γ) are upregulated, which appears to have a regulatory relationship with occludin expression .

  • Recovery mechanisms: Vaccination strategies that effectively control coccidiosis have been shown to prevent the downregulation of occludin and other junction proteins (e.g., JAM2) during challenge infections .

  • Barrier restoration: Effective immune interventions, such as vaccination with recombinant EF-1α combined with immunomodulators like chicken IL-7 or NK-lysin peptide 2, help maintain occludin expression levels during pathogen challenge, contributing to preserved gut barrier function .

The interaction between occludin regulation and immune response offers promising avenues for developing strategies to protect intestinal barrier function during enteric infections in poultry. Researchers have observed that occludin expression, along with other tight junction proteins, was significantly decreased following E. maxima infection but maintained in vaccinated groups, particularly those receiving combined immunomodulatory approaches .

How can recombinant chicken occludin be utilized to develop novel therapeutic approaches for intestinal diseases in poultry?

Recombinant chicken occludin offers several potential therapeutic applications:

  • Barrier-enhancing formulations: Developing feed additives or supplements that upregulate or stabilize occludin expression to strengthen intestinal barrier function.

  • Vaccine adjuvant development: Research indicates that maintaining occludin expression is associated with improved vaccine efficacy against enteric pathogens like Eimeria. Co-administration of immunomodulatory molecules like chicken IL-7 or NK-lysin peptide with vaccines helps preserve occludin expression during challenge .

  • Biomarker for intestinal health: Using occludin expression levels as a biomarker to evaluate the efficacy of therapeutic interventions or feed additives on intestinal barrier integrity.

  • Screening platform: Developing high-throughput screening systems using recombinant chicken occludin to identify compounds that prevent tight junction disruption during enteric challenges.

  • Structure-based drug design: Using the structural information from recombinant chicken occludin to design molecules that specifically interact with occludin to enhance barrier function.

Research has demonstrated that vaccination strategies that maintain occludin expression during pathogen challenge correlate with improved intestinal health metrics, including reduced lesion scores and oocyst shedding in coccidiosis models . This suggests that therapeutic approaches targeting occludin stability or expression could be valuable in preventing intestinal diseases in poultry.

What approaches are effective for studying chicken occludin interactions with other tight junction proteins?

Several methodological approaches have proven effective for investigating chicken occludin interactions:

  • Co-immunoprecipitation (Co-IP): Isolating occludin complexes from chicken tissues or cell lines using specific antibodies and identifying interacting partners through mass spectrometry or Western blotting.

  • Proximity ligation assay (PLA): Detecting protein-protein interactions in situ with high sensitivity and spatial resolution.

  • Förster resonance energy transfer (FRET): Measuring direct protein interactions in living cells by tagging occludin and potential partners with appropriate fluorophores.

  • Bimolecular fluorescence complementation (BiFC): Visualizing protein interactions by expressing occludin and binding partners as fusion proteins with complementary fragments of a fluorescent protein.

  • Surface plasmon resonance (SPR): Quantitatively analyzing binding kinetics between purified recombinant chicken occludin and other tight junction components.

  • Yeast two-hybrid screening: Identifying novel interaction partners from chicken intestinal or epithelial cDNA libraries.

  • Cryo-electron microscopy: Visualizing multiprotein complexes containing occludin at molecular resolution.

Studies with recombinant chicken occludin expressed in insect cells have demonstrated that occludin can form tight junction-like structures that can be specifically labeled with monoclonal antibodies, providing a system for studying occludin assembly into junctional complexes . This experimental approach allows for detailed investigation of the structural requirements and protein interactions necessary for tight junction formation.

What are common challenges in producing soluble and functional recombinant chicken occludin?

Researchers face several challenges when producing recombinant chicken occludin:

  • Membrane protein solubility: As an integral membrane protein with four transmembrane domains, occludin is inherently hydrophobic and prone to aggregation during expression and purification.

  • Proper folding: Ensuring correct folding of the four transmembrane domains and extracellular loops is challenging in heterologous expression systems.

  • Post-translational modifications: Different expression systems vary in their ability to provide proper phosphorylation and other modifications essential for occludin function.

  • Detergent selection: Identifying detergents that effectively solubilize occludin while preserving its native structure and function requires extensive optimization.

  • Stability issues: Purified recombinant occludin may undergo time-dependent degradation or aggregation.

Recommended solutions:

  • Use eukaryotic expression systems like insect cells with baculovirus that have demonstrated success in producing functional chicken occludin

  • Screen multiple detergents (CHAPS, DDM, Triton X-100) for optimal solubilization

  • Consider fusion tags (MBP, SUMO) to enhance solubility

  • Maintain detergent concentrations above CMC throughout purification

  • Add stabilizing agents (glycerol, specific lipids) to purification buffers

  • Perform quality control at each purification step

Successful expression has been achieved using baculovirus systems, where recombinant chicken occludin formed characteristic multilamellar structures resembling tight junctions, indicating proper folding and function .

How can researchers differentiate between functional and non-functional recombinant chicken occludin preparations?

Distinguishing functional from non-functional recombinant chicken occludin requires multiple analytical approaches:

Structural Indicators:

  • Circular dichroism (CD) spectroscopy: Confirms proper secondary structure with expected alpha-helical content from transmembrane domains.

  • Thermal shift assays: Functional protein typically shows cooperative unfolding and higher thermal stability.

  • Size exclusion chromatography: Monomeric or properly oligomeric state versus aggregated forms.

  • Limited proteolysis: Correctly folded protein shows characteristic proteolytic fragmentation patterns.

Functional Assays:

  • Membrane incorporation: Ability to incorporate into liposomes or artificial membranes.

  • Formation of multilamellar structures: When overexpressed in appropriate systems, functional chicken occludin forms characteristic multilamellar structures that can be observed by electron microscopy .

  • Binding to known partners: Interaction with ZO-1 or other tight junction proteins using pull-down assays.

  • Phosphorylation acceptance: Ability to serve as a substrate for kinases known to modify occludin.

Cellular Assays:

  • Localization studies: When expressed in epithelial cells, functional occludin should localize to cell-cell contacts.

  • Barrier function restoration: Ability to restore barrier function in occludin-depleted cell models.

The formation of tight junction-like multilamellar structures when overexpressed in insect cells has been established as a key indicator of functional recombinant chicken occludin . These structures show characteristic fusion of opposing membrane leaflets similar to native tight junctions, which can be verified by electron microscopy and immunolabeling with occludin-specific antibodies.

What quality control measures ensure consistent biological activity of recombinant chicken occludin between batches?

Ensuring batch-to-batch consistency of recombinant chicken occludin requires implementing rigorous quality control protocols:

Physical and Chemical Characterization:

  • SDS-PAGE and Western blotting: Confirm consistent protein size and immunoreactivity

  • Mass spectrometry: Verify protein identity and detect modifications or truncations

  • Circular dichroism: Ensure consistent secondary structure content

  • Dynamic light scattering: Monitor protein homogeneity and detect aggregation

  • Isoelectric focusing: Assess charge heterogeneity that might indicate variable modifications

Functional Quality Controls:

  • Binding assays: Quantitative measurement of interaction with known binding partners

  • Phosphorylation acceptance: Consistency in serving as a substrate for relevant kinases

  • Multilamellar structure formation: Consistent ability to form characteristic structures when overexpressed

Process Controls:

  • Expression conditions: Standardize cell density, infection timing, and harvest point

  • Purification protocols: Validate each chromatography step with defined acceptance criteria

  • Storage stability: Monitor activity retention during storage under defined conditions

  • Endotoxin testing: Ensure preparations are endotoxin-free for cell-based applications

Documentation:

  • Detailed batch records tracking all parameters from expression through purification

  • Certificate of analysis for each batch including purity, activity, and stability data

  • Reference standards to compare new batches against validated preparations

Implementing these measures will help ensure that different batches of recombinant chicken occludin maintain consistent structural integrity and functional activity for research applications.

How is recombinant chicken occludin being used to understand gut health and immunity in poultry?

Recombinant chicken occludin is increasingly being utilized to study the relationship between intestinal barrier function and immune responses in poultry:

  • Barrier-immune axis exploration: Researchers are investigating how tight junction proteins like occludin mediate communication between epithelial barrier status and immune activation in the gut.

  • Pathogen response studies: Recombinant occludin is being used to understand how enteric pathogens like Eimeria maxima disrupt tight junctions. Studies have shown that E. maxima infection significantly decreases occludin expression in the chicken jejunum, correlating with increased intestinal permeability and pathology .

  • Cytokine regulation of barrier function: Research demonstrates that pro-inflammatory cytokines (IL-6, IL-10, IFN-γ) induced during infection influence occludin expression and localization . This relationship is bidirectional, with barrier disruption also affecting cytokine profiles.

  • Vaccination impact assessment: Studies have shown that vaccination strategies against coccidiosis help maintain occludin expression during challenge infections. Co-administration of vaccine antigens with immunomodulators like chicken IL-7 or NK-lysin peptide 2 (cNK-2) better preserves intestinal barrier function, including occludin expression .

  • Biomarker development: Occludin expression is being evaluated as a biomarker for intestinal health and vaccine efficacy in poultry. Reduced jejunal lesion scores correlate with preserved occludin expression following vaccination and challenge .

These studies highlight the critical role of occludin in maintaining intestinal homeostasis during immune challenges and provide insights into developing strategies that preserve barrier function during enteric infections in poultry.

What role might recombinant chicken occludin play in developing novel vaccines or therapeutics for poultry diseases?

Recombinant chicken occludin has significant potential in vaccine and therapeutic development for poultry:

  • Adjuvant development: Understanding how occludin expression correlates with vaccine efficacy helps optimize adjuvant formulations. Research shows that vaccines co-administered with immunomodulators like chicken IL-7 or NK-lysin peptide 2 better maintain occludin expression during challenge, suggesting these molecules could serve as effective adjuvants for intestinal health .

  • Barrier-protective formulations: Developing feed additives or biologics that specifically target occludin preservation during infection could protect against enteric diseases.

  • Efficacy biomarker: Occludin expression levels serve as a measurable indicator of vaccine efficacy against enteric pathogens. Studies have demonstrated that enhanced protection against coccidiosis correlates with maintained occludin expression in the intestine .

  • Molecular targets: Detailed understanding of occludin structure and function provides targets for developing molecules that specifically enhance tight junction stability during infection.

  • Delivery systems: Recombinant occludin research informs the development of mucosal delivery systems for vaccines that preserve barrier function while stimulating appropriate immune responses.

Research has shown that vaccination strategies that effectively control coccidiosis also prevent the downregulation of occludin during infection . Specifically, chickens immunized with recombinant EF-1α combined with chicken IL-7 showed significantly improved body weights following E. maxima challenge, which correlated with preserved intestinal barrier function and occludin expression .

How do comparative studies of chicken occludin with mammalian versions advance our understanding of epithelial barriers?

Comparative studies between chicken and mammalian occludin provide valuable insights into conserved and species-specific aspects of tight junction biology:

  • Evolutionary conservation: Structural comparisons reveal highly conserved transmembrane domains across species, indicating fundamental roles in tight junction formation. The ability of chicken occludin to form tight junction-like structures when overexpressed demonstrates conservation of basic functional mechanisms .

  • Species-specific adaptations: Differences in regulatory regions and phosphorylation sites between avian and mammalian occludin reflect adaptations to species-specific physiological demands.

  • Pathogen interaction differences: Comparing how avian and mammalian pathogens interact with their host's occludin reveals evolution of virulence mechanisms and potential species barriers to infection.

  • Developmental regulation: Studies on occludin dephosphorylation during development in different species highlight conserved regulatory mechanisms in epithelial differentiation .

  • Pharmacological responses: Differential responses to tight junction modulators between species inform the development of species-specific therapeutics.

  • Barrier physiology: Comparing the relationship between occludin structure and barrier properties in different species helps understand fundamental principles of epithelial barrier regulation.

These comparative approaches not only advance basic understanding of tight junction biology but also have practical applications in developing species-appropriate interventions for epithelial barrier dysfunction. The finding that chicken occludin forms characteristic multilamellar structures when overexpressed in insect cells provides an important model system for studying tight junction assembly mechanisms that may be applicable across species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.