Recombinant Chicken Olfactory receptor-like protein COR1 (COR1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of COR1

Gene Information

  • Gene Symbol: COR1

  • Synonyms: OLFR3B, cor3, COR3b

  • UniProt ID: P37067

  • Protein Name: Olfactory receptor-like protein COR1

Table 1: Key Sequence Features

FeatureDetails
Expression Region1–318 (full-length protein)
Signal PeptideNot explicitly identified; structural modeling suggests GPCR motifs.
Conserved ResiduesCritical for ligand binding and G-protein coupling .

Recombinant Production Methods

Recombinant COR1 is generated using heterologous expression systems to study its biochemical and functional properties.

Expression Systems

  • Hosts: E. coli, yeast, baculovirus, and mammalian cells .

  • Purification: ≥85% purity confirmed by SDS-PAGE .

  • Tags: Variable (determined during production; commonly polyhistidine or GST) .

Table 2: Expression and Purification Parameters

ParameterDetails
Host FlexibilityCompatible with prokaryotic and eukaryotic systems .
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C .
StabilitySensitive to repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week .

Developmental Roles

  • COR1 is expressed in the chicken olfactory epithelium as early as embryonic day 5 (E5) .

  • Alongside COR2–COR6, it shows high expression levels during early embryogenesis, with labeled cells extending along the olfactory nerve to the forebrain . This suggests a potential role in neurodevelopmental guidance or axon targeting .

Olfactory vs. Non-Olfactory Functions

  • Unlike COR7b (a related subfamily member), COR1 is not detected in non-olfactory tissues like the notochord .

  • COR1-positive cells are randomly distributed in the olfactory epithelium, consistent with odorant receptor expression patterns in vertebrates .

Applications in Research

  • Odorant Receptor Studies: Used to investigate ligand specificity and signaling mechanisms in avian olfaction .

  • Developmental Biology: Serves as a marker for studying olfactory neuron differentiation and axon pathfinding .

  • Structural Biology: Recombinant COR1 enables crystallization and GPCR dynamics analysis .

Comparative Insights

Table 3: COR1 vs. Other COR Subfamily Members

FeatureCOR1COR7b
Tissue SpecificityOlfactory epithelium only Olfactory epithelium + notochord
Developmental StageE5 to adulthood Transient notochord expression (E2–E6)
Functional RoleOdor detection Dual role in olfaction and dorsoventral patterning

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be selected during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of the specified tag.
Synonyms
COR1; Olfactory receptor-like protein COR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
COR1
Target Protein Sequence
MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIALISVDLHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERKTISYVGCILQYFSFVLLTVTESLLLAVMAY DRYVAICKPLLYPSIMTKAVCWRLVESLYFLAFLNSLVHTSGLLKLSFCYSNVVNHFFCD ISPLFQISSSSIAISELLVIISGSLFVMSSIIIILISYVFIILTVVMIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRLTATTFGFIDSKAVQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

KEGG: gga:428829

UniGene: Gga.32088

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Chicken Olfactory receptor-like protein COR1?

Recombinant Chicken Olfactory receptor-like protein COR1 (COR1) is a member of the chicken olfactory receptor family, which belongs to the broader class of G-protein-coupled receptors containing seven transmembrane domains. These receptors are primarily involved in odor detection in vertebrates including fish, rat, mouse, dog, and human . COR1 specifically refers to a recombinant form of this protein that has been produced in laboratory conditions for research purposes. The protein is part of a larger gene family of olfactory receptors in chickens that has been characterized and subdivided into distinct subfamilies . COR1 plays a crucial role in the olfactory system of chickens and may have additional functions in development and cellular signaling pathways.

The recombinant form of COR1 is typically expressed in various host systems including E. Coli, yeast, baculovirus, or mammalian cells, with a purity level of at least 85% as determined by SDS-PAGE analysis . This purified recombinant protein serves as a valuable tool for researchers investigating olfactory mechanisms, developmental biology, and potential non-olfactory functions of these receptor proteins.

What are the alternative names and identifiers for COR1?

The Recombinant Chicken Olfactory receptor-like protein COR1 is known by several alternative names and identifiers in scientific literature and databases. These include OLFR3B, cor3, and COR3b . The protein is also sometimes referred to descriptively as "olfactory receptor-like protein COR1" or "olfactory receptor 3B" . These alternative designations reflect the evolution of nomenclature as our understanding of this protein family has advanced.

Understanding these alternative names is crucial when conducting literature searches or database queries, as different research groups may use different nomenclature in their publications. Additionally, when designing primers or antibodies for COR1 detection, researchers should be aware of these alternative designations to ensure comprehensive coverage of relevant sequences and to avoid confusion with other olfactory receptor proteins that may have similar naming conventions.

What is known about the COR gene family in chickens?

The chicken olfactory receptor (COR) gene family comprises a complex set of genes that encode olfactory receptors. Based on current research, the COR gene family consists of 12 members that have been subdivided into six distinct subfamilies . Each subfamily represents a group of related genes with high sequence similarity. For instance, the COR7 subfamily includes two highly related genes, COR7a and COR7b, which share 98.5% identity at the nucleic acid level and 96.6% at the amino acid level .

The COR gene family in chickens appears to be smaller than the olfactory receptor gene families found in mammals, which can include several hundred members. This may reflect differences in the relative importance of olfaction across species or evolutionary divergence in sensory systems. Despite their primary role in olfaction, members of the COR gene family have also been found to be expressed in non-olfactory tissues during development, suggesting additional functions beyond odor detection . For example, some COR genes have been detected in cells migrating along the olfactory nerve at embryonic day 5 (E5), indicating potential roles in the morphogenesis of the avian olfactory system .

How is COR1 typically expressed in the chicken olfactory system?

In the chicken olfactory system, COR1 expression follows a specific spatiotemporal pattern that is characteristic of olfactory receptors. Based on studies of similar olfactory receptors like COR7, these proteins are primarily expressed in olfactory neurons that are randomly distributed throughout the olfactory epithelium . Expression of olfactory receptors generally begins during embryonic development and continues through to hatching, although the exact timing may vary between different receptor subtypes.

For closely related olfactory receptors such as COR7a and COR7b, research has shown that expression can be detected in the olfactory epithelium from embryonic day 6 (E6) through to hatching . The number of cells expressing these receptors can vary during development, with possible fluctuations that may correspond to critical developmental periods. Importantly, studies indicate that individual olfactory neurons typically express only one type of olfactory receptor gene, maintaining the specificity of odor detection . This "one neuron-one receptor" rule appears to be conserved across different vertebrate species and is crucial for the proper functioning of the olfactory system.

What methodological considerations are important when studying COR1 expression during different developmental stages?

When investigating COR1 expression across developmental stages, researchers must implement rigorous methodological approaches to ensure accurate and reliable results. In situ hybridization represents a primary technique for visualizing COR1 expression patterns in tissue sections. When designing in situ hybridization experiments, particular attention must be paid to probe specificity, especially given the high sequence similarity between related olfactory receptor genes. For example, studies on COR7a and COR7b, which share 98.5% sequence identity, required the development of highly specific probes to distinguish between these closely related genes .

Sample collection and preservation techniques significantly impact the quality of developmental expression data. Researchers should collect samples at consistent time points (e.g., E2, E6, E18, hatching) across multiple specimens (approximately 10 animals with 30 sections per timepoint) to achieve statistical significance and account for individual variations . Additionally, researchers should consider potential diurnal variations in gene expression and standardize collection times accordingly. When analyzing expression patterns, quantification methods should account for both the number of positive cells and the intensity of expression, which may provide insights into the relative abundance of the receptor at different developmental stages.

What experimental approaches are optimal for investigating COR1 function?

Investigating COR1 function requires a multi-faceted experimental approach that addresses both its canonical role in olfaction and potential non-olfactory functions. Heterologous expression systems represent a cornerstone technique, wherein COR1 is expressed in cell lines (such as HEK293 or Xenopus oocytes) to study its ligand binding properties and signaling capabilities. These systems allow for controlled manipulation of receptor expression and facilitate high-throughput screening of potential ligands using calcium imaging or cAMP assays to detect receptor activation.

For studying COR1 in its native context, CRISPR/Cas9-mediated genome editing in chicken embryos provides a powerful approach for generating receptor knockouts or introducing reporter constructs at the endogenous locus. This technique enables direct visualization of COR1-expressing cells and assessment of phenotypic consequences following receptor ablation. Additionally, electrophysiological recordings from olfactory neurons expressing COR1 can provide valuable insights into the receptor's response properties to various odorants.

To investigate potential developmental roles, ex vivo culture systems of chicken embryos coupled with temporally controlled overexpression or knockdown of COR1 can reveal its functions during critical developmental windows. Techniques such as in ovo electroporation allow for targeted manipulation of COR1 expression in specific tissues, including the developing olfactory epithelium and notochord. These approaches should be complemented by detailed phenotypic analyses using immunohistochemistry, RNA sequencing, and behavioral assays to comprehensively characterize COR1 function across multiple biological contexts.

What challenges exist in distinguishing COR1 from other similar olfactory receptors?

Distinguishing COR1 from other closely related olfactory receptors presents several significant challenges due to the high sequence homology within the COR gene family. As demonstrated with COR7a and COR7b, which share 98.5% nucleotide identity, standard molecular techniques may lack the resolution to differentiate between such closely related family members . This high sequence similarity complicates primer and probe design for PCR, in situ hybridization, and other nucleic acid-based detection methods.

At the protein level, generating specific antibodies against COR1 is particularly challenging due to the conserved structural features among olfactory receptors. Researchers must carefully identify unique epitopes within COR1 that differ from other family members to develop truly specific antibodies. Even with careful design, cross-reactivity remains a significant concern and necessitates extensive validation through multiple approaches, including using tissues from knockout models as negative controls.

Another challenge emerges from the potential overlapping expression patterns of different COR family members. As observed with COR7a and COR7b, multiple receptors may be expressed in the same tissue but in different cell populations . Distinguishing these patterns requires high-resolution techniques such as single-cell RNA sequencing or highly specific in situ hybridization protocols. Additionally, functional redundancy between closely related receptors may mask phenotypes in single-gene knockout studies, necessitating more complex genetic approaches such as double or triple knockouts to reveal the full spectrum of receptor functions.

How can I design an experiment to investigate COR1 expression in non-olfactory tissues?

Designing experiments to investigate COR1 expression in non-olfactory tissues requires a comprehensive approach that combines multiple complementary techniques. Begin with a broad screening strategy using RT-PCR on RNA extracted from various tissues at different developmental stages, similar to the approach used to detect COR7b in the notochord . This initial screen should include tissues derived from all three germ layers to identify unexpected expression domains.

For tissues showing positive RT-PCR results, proceed with in situ hybridization to precisely localize COR1 expression at the cellular level. Design highly specific RNA probes that target unique regions of COR1 to avoid cross-reactivity with other COR family members. Include appropriate positive controls (such as olfactory epithelium sections) and negative controls (such as sense probes or tissues known not to express COR1) in each experiment. When analyzing notochord expression, include adjacent sections hybridized with established notochord markers like Sonic Hedgehog (SHH) as positive controls .

The experimental design should include a comprehensive developmental time course, focusing on key stages of embryonic development (e.g., E2, E6, E10, E14, E18, and hatching) to capture dynamic changes in expression patterns. For each stage, analyze multiple specimens (approximately 10 animals) with multiple sections per specimen (approximately 30 sections) to ensure statistical robustness . Complementary approaches such as immunohistochemistry with validated COR1-specific antibodies and fluorescent reporter constructs driven by the COR1 promoter in transgenic models can provide additional validation of expression patterns.

What controls should be included in experiments investigating COR1 function?

Robust experimental design for investigating COR1 function necessitates several categories of controls to ensure valid and reproducible results. For expression studies using in situ hybridization, include both technical controls (sense probes, RNase-treated sections) and biological controls (tissues known to express or not express COR1). When examining expression in non-olfactory tissues such as the notochord, include adjacent sections hybridized with established markers like Sonic Hedgehog as positive controls, which serve as reference points for tissue identification and sample quality .

In functional studies using heterologous expression systems, essential controls include mock-transfected cells, cells expressing well-characterized olfactory receptors with known ligands, and cells expressing closely related COR family members to assess specificity of observed responses. For calcium imaging or cAMP assays measuring receptor activation, include both positive controls (compounds known to activate G-protein signaling pathways) and negative controls (compounds structurally unrelated to potential ligands).

For genetic manipulation studies (knockdown, knockout, or overexpression), implement appropriate controls that account for potential off-target effects. For CRISPR/Cas9 experiments, include multiple guide RNAs targeting different regions of COR1 to confirm phenotypic consistency, as well as control guide RNAs targeting non-coding regions. In rescue experiments, use both wild-type COR1 and mutated versions (e.g., with altered binding domains) to demonstrate specificity of the observed phenotypes. When studying potential developmental functions, include stage-specific manipulations to determine critical windows of COR1 activity.

How can I optimize purification of Recombinant COR1 protein?

Optimizing purification of Recombinant COR1 protein presents unique challenges due to its seven-transmembrane domain structure, which is characteristic of G-protein coupled receptors. Based on established protocols for similar proteins, a systematic approach to purification optimization should address expression system selection, detergent solubilization, and chromatographic purification strategies. Begin by evaluating different expression systems including E. coli, yeast, baculovirus, and mammalian cells to determine which provides the highest yield of properly folded protein . For membrane proteins like COR1, insect cell and mammalian expression systems often provide superior results compared to bacterial systems.

For solubilization, screen a panel of detergents with varying properties, including mild non-ionic detergents (DDM, LMNG), zwitterionic detergents (CHAPS, CHAPSO), and newer amphipols or nanodiscs that can maintain protein stability during purification. Optimize detergent concentration, temperature, and incubation time to maximize extraction efficiency while preserving protein structure and function. Consider incorporating lipids during solubilization to maintain the native-like environment of the receptor.

For chromatographic purification, implement a multi-step approach beginning with affinity chromatography using either a fusion tag (His, FLAG, or GST) or a ligand-based affinity column if ligands are known. Follow with size exclusion chromatography to separate monomeric COR1 from aggregates and other contaminants. Consider including an ion exchange chromatography step if higher purity is required. Throughout the purification process, monitor protein quality using both SDS-PAGE and functional assays to ensure the purified protein maintains its native conformation and activity. Aim for a final purity of at least 85% as determined by SDS-PAGE analysis, consistent with commercial standards for recombinant COR1 .

What data table format is most appropriate for presenting COR1 expression across developmental stages?

When presenting COR1 expression data across developmental stages, an effective data table should balance comprehensiveness with clarity, enabling readers to quickly understand temporal expression patterns while providing sufficient detail for critical analysis. Below is an example of an optimized data table format for this purpose:

Developmental StageCOR1-Positive Cells/Section (Mean ± SD)Relative Expression LevelExpression PatternNon-Olfactory Tissues with Expression
E2 (HH13)0 ± 0Not detectedN/ANotochord
E6 (HH29)42 ± 8LowScatteredNotochord
E10 (HH36)87 ± 12ModerateClusteredNone detected
E14 (HH40)146 ± 18HighWidespreadNone detected
E18 (HH44)68 ± 15ModerateClusteredNone detected
Hatching (HH46)175 ± 22HighWidespreadNone detected

This table structure follows scientific data presentation best practices by including clear row and column headers, appropriate units of measurement, and statistical parameters (mean and standard deviation)3. The inclusion of Hamburger-Hamilton (HH) staging alongside embryonic days (E) provides standardized developmental reference points. Qualitative descriptors (low, moderate, high) for expression levels complement the quantitative cell counts, offering a more intuitive understanding of expression dynamics.

The "Expression Pattern" column captures the spatial distribution of COR1-positive cells, while the final column highlights any expression in non-olfactory tissues, similar to the documented expression of COR7b in the notochord . This comprehensive format facilitates comparisons between developmental stages and enables identification of potential critical periods for COR1 function during development.

How can I interpret contradictory data regarding COR1 expression?

Temporal dynamics can also account for apparent contradictions in expression data. As observed with COR7 receptors, expression levels can fluctuate significantly during development, with peaks and troughs at different embryonic stages . Studies sampling at different timepoints might capture these variations and report seemingly contradictory results. Similarly, spatial heterogeneity in expression patterns may lead to inconsistent findings if sampling methods differ between studies. The random distribution of olfactory neurons expressing specific receptors throughout the olfactory epithelium means that section-to-section variability can be substantial .

To reconcile contradictory data, implement a multi-technique validation approach. Combine in situ hybridization with RT-PCR, qPCR, and potentially RNAseq or single-cell sequencing to build a more comprehensive picture of expression patterns. When possible, use genetic approaches such as reporter knock-ins to directly visualize expression patterns in vivo. Finally, consider collaborating with other laboratories to perform side-by-side comparisons using identical samples and multiple technical approaches to definitively resolve contradictions.

What statistical approaches are recommended for analyzing COR1 expression data?

The analysis of COR1 expression data requires robust statistical approaches tailored to the specific experimental design and data characteristics. For quantitative analyses of cell counts from in situ hybridization experiments, begin with descriptive statistics including means, standard deviations, and confidence intervals to characterize expression levels across different developmental stages or tissues. When comparing COR1 expression across multiple developmental timepoints, apply repeated measures ANOVA followed by appropriate post-hoc tests (such as Tukey's HSD) to identify significant changes while controlling for multiple comparisons.

For spatial distribution analyses, consider specialized statistical methods that account for the non-random distribution of receptor-expressing cells. Nearest neighbor analysis and Ripley's K-function can reveal whether COR1-expressing cells exhibit clustering or dispersion patterns within the olfactory epithelium. These approaches provide insights into the spatial organization of sensory neurons that may reflect functional specialization.

When analyzing RNA sequencing data, employ differential expression analysis using established packages such as DESeq2 or edgeR, with appropriate normalization methods to account for library size differences and potential batch effects. For single-cell RNA sequencing data, dimension reduction techniques (t-SNE, UMAP) followed by clustering analyses can identify cell populations expressing COR1 and characterize their transcriptional profiles. When examining potential co-expression patterns between COR1 and other genes, calculate correlation coefficients (Pearson's or Spearman's) and apply correction for multiple testing to control false discovery rates.

How can I compare my COR1 expression data with published findings?

Effectively comparing your COR1 expression data with published findings requires a structured approach that addresses methodological differences, standardizes quantification metrics, and contextualizes results within the broader literature. Begin by creating a standardized framework for comparison, aligning your developmental staging system with those used in published studies. For avian studies, the Hamburger-Hamilton (HH) staging system provides a universal reference point that transcends variations in embryonic day (E) designations across different chicken strains.

Develop normalized expression metrics that facilitate direct comparisons despite methodological differences. For example, when comparing in situ hybridization data, calculate the percentage of COR1-positive cells relative to total cells in the olfactory epithelium rather than relying solely on absolute cell counts. This approach mitigates discrepancies arising from differences in section thickness or tissue processing methods. Similarly, for RT-PCR or qPCR data, use identical reference genes for normalization when reanalyzing your data alongside published values.

Create comparative visualization tools such as overlaid temporal expression profiles that incorporate data from multiple studies with error bars reflecting study-specific variability. When sufficient data are available from multiple sources, consider performing a mini meta-analysis using standardized effect sizes to quantitatively synthesize findings across studies. This approach is particularly valuable when reconciling seemingly contradictory results, similar to the fluctuations observed in COR7a and COR7b expression during development .

For spatial expression patterns, develop standardized anatomical reference maps that allow precise registration of expression domains from different studies. This approach is especially useful when comparing expression in non-olfactory tissues, such as the notochord expression observed for COR7b . Finally, engage directly with authors of published studies to resolve discrepancies and potentially establish collaborative efforts to harmonize experimental approaches and data interpretation in the field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.