Recombinant Chicken Olfactory receptor-like protein COR3 (COR3)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Phylogenetic Classification

The COR3 gene is part of a larger family of olfactory receptor-like genes in chickens. Key findings include:

  • COR3 is located near the β-globin locus, downstream of a chromatin boundary marked by a constitutive DNase I hypersensitive site (3′HS) .

  • This genomic positioning suggests regulatory independence from neighboring genes, with expression observed in olfactory epithelium and embryonic brain tissue .

  • COR3 shares structural motifs with class A G protein-coupled receptors (GPCRs), including seven transmembrane domains and conserved hydrophobic patterns .

Expression and Tissue Distribution

Available data on COR family members provide indirect insights:

  • Olfactory Epithelium: COR3 transcripts are detected in embryonic chicken olfactory neurons, similar to COR7a/COR7b .

  • Non-Olfactory Tissues: Some COR genes (e.g., COR3′β) show transient expression in the notochord during early embryogenesis (E2–E6) .

Table 1: Expression Profiles of COR Family Members

COR GeneTissue ExpressionDevelopmental StageSource
COR3′βOlfactory epithelium, brainEmbryonic (E6–hatching)
COR7a/COR7bOlfactory epitheliumEmbryonic (E6–hatching)
COR1/COR8Recombinant expression in E. coli, yeastIn vitro

Functional Implications

COR3 likely shares roles with other OR-like proteins:

  • Metabolite Sensing: ORs such as Olfr558 detect microbial metabolites (e.g., short-chain fatty acids), hinting at COR3’s potential role in host-microbe interactions .

  • Signaling Pathways: OR activation typically couples with Gα<sub>olf</sub> proteins, elevating cAMP and modulating neuronal activity .

Research Gaps and Challenges

  • Ligand Specificity: No ligands have been identified for COR3, unlike Olfr558 or OR51E1 .

  • In Vivo Function: Its role in the notochord remains speculative, though conserved boundary elements suggest developmental regulation .

Comparative Analysis with Human Orthologs

  • OR51E1: The human ortholog of Olfr558 shares ligand specificity for carboxylic acids, indicating functional conservation .

  • MOR3′β: Mouse homologs of COR3′β show overlapping expression in olfactory and erythroid tissues .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type preferences, please inform us, and we will prioritize the development of the specified tag.
Synonyms
COR3; Olfactory receptor-like protein COR3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
COR3
Target Protein Sequence
MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIRLISVDLHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERKTISYVGCILQYFSFVLLTTSECLLLAVMAY DRYVAICKPLLYPAIMTKAVCWRLVESLYFLAFLNSLVHTCGLLKLSFCYSNVVNHFFCD ISPLFQISSSSIAISELLVIISGSLFVMSSIIIILISYVFIILTVVMIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRLTATTFGFIDSKAVQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

UniGene: Gga.32088

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Chicken Olfactory receptor-like protein COR3 and what is its structural classification?

Chicken Olfactory receptor-like protein COR3 (COR3) belongs to the superfamily of seven-transmembrane domain proteins, which are G protein-coupled receptors involved in olfactory sensation. COR3 is one of several olfactory receptor genes that have been cloned and characterized in avian systems. Like other olfactory receptors, it likely contains the characteristic seven transmembrane domains with extracellular and intracellular loops that facilitate signal transduction upon odorant binding .

The protein is encoded by the COR3 gene in Gallus gallus (chicken) and is typically studied as either the full-length receptor or as partial recombinant fragments depending on the experimental objectives. When expressed recombinantly, COR3 can be tagged with various fusion partners to facilitate detection and purification .

When and where is COR3 expressed during avian development?

COR3 expression follows a specific developmental timeline in birds:

  • Initial expression begins early in placodal cells at Embryonic Day 5 (E5)

  • Changes in expression pattern correlate with the onset of synaptogenesis (E8)

  • The adult expression pattern is achieved before hatching

  • Within the mature olfactory epithelium, cells expressing a particular COR are not regionalized but rather distributed throughout the epithelium

Interestingly, COR3 expression is not strictly limited to the olfactory epithelium during early developmental stages (before synaptogenesis). At these early stages, cells distributed along the olfactory nerve from the placode to the anterior telencephalon also express CORs. This cell population is distinct from the luteinizing hormone releasing hormone neurons that migrate from the placode .

What expression systems are available for producing recombinant COR3 protein?

Multiple expression systems are available for producing recombinant COR3 protein, each offering distinct advantages for different experimental applications:

Expression SystemAdvantagesCommon ApplicationsProduct Format
YeastPost-translational modifications, proper foldingStructural studies, binding assaysLyophilized powder
E. coliHigh yield, cost-effective, rapid expressionAntibody production, protein interaction studiesLyophilized powder
E. coli with in vivo biotinylationSite-specific biotin labeling via AviTag-BirA technologyProtein-protein interaction studies, pull-down assaysBiotinylated protein
BaculovirusEukaryotic post-translational modifications, high expression levelsFunctional studies, structural analysisLyophilized powder
Mammalian cellNative-like modifications, proper foldingFunctional assays, cell-based receptor studiesLyophilized powder

The recombinant proteins typically achieve >85% purity as assessed by SDS-PAGE and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What methods are most effective for studying COR3 gene expression patterns?

In situ hybridization has proven particularly effective for studying COR3 expression patterns during development and in response to experimental manipulations:

  • Single-label in situ hybridization allows visualization of the spatiotemporal expression pattern of COR3

  • Double-label in situ hybridization enables researchers to determine whether individual cells express multiple COR genes simultaneously (research shows they do not)

  • Combined with immunohistochemistry, these techniques can correlate COR3 expression with specific cell types or developmental markers

For quantitative analysis of expression levels, quantitative PCR (qPCR) can complement the spatial information provided by in situ hybridization.

How does COR3 respond to experimental manipulations of the olfactory system?

Experimental manipulations provide insights into the regulation and function of COR3:

Following bulbar deafferentation (severing connections between the olfactory epithelium and olfactory bulb):

  • COR3 expression ceases more rapidly than expected from previous axotomy experiments

  • Concomitantly, reactivation of the Cash-1 gene (involved in early neuronal specification) occurs, potentially signaling the beginning of olfactory neuronal regeneration

  • These expression changes indicate simultaneous processes of neuronal degeneration and regeneration in the olfactory epithelium after axotomy

This experimental approach reveals the dependency of COR3 expression on intact connections with the olfactory bulb and highlights the dynamic nature of olfactory neuron turnover and regeneration.

What is known about the specificity of individual olfactory neurons expressing COR3?

Research using double-label in situ hybridization has clearly demonstrated that a single olfactory neuron does not coexpress different COR genes (or subsets of CORs) at any stage of development . This finding is consistent with the "one neuron-one receptor" rule observed in mammalian olfactory systems, where each olfactory sensory neuron expresses only one type of olfactory receptor.

This specificity is fundamental to the organization of the olfactory system and its ability to discriminate between different odorants. The mechanisms ensuring this selectivity in avian systems may involve regulatory elements similar to those identified in mammalian olfactory receptor expression.

How does the avian olfactory system compare to mammalian olfactory systems?

The avian olfactory system offers several advantages as a developmental model:

  • Simpler structure compared to mammalian systems

  • Attractive model for studying olfactory morphogenesis and differentiation

  • Follows similar organizational principles (such as the one neuron-one receptor rule)

While birds were historically thought to have limited olfactory capabilities compared to mammals, research on avian olfactory receptors including COR3 has revealed sophisticated olfactory systems with structural and functional similarities to mammalian counterparts, though typically with fewer receptor types.

What methodological approaches can be used to identify potential ligands for COR3?

While the specific ligands for COR3 have not been definitively identified in the provided search results, approaches used for other olfactory receptors can be applied to COR3 research:

  • Heterologous expression systems:

    • Expression in cell lines (like HEK293 cells) coupled with calcium imaging or cAMP assays

    • Functional expression in Xenopus oocytes with electrophysiological recordings

  • High-throughput screening approaches:

    • Similar to those used for the murine olfactory receptors described in

    • Testing panels of potential ligands including carboxylic acids, aldehydes, and other volatile compounds

  • Structure-based virtual screening:

    • Using homology modeling based on known GPCR structures

    • Molecular docking of potential ligands to predict binding affinities

Based on studies of other olfactory receptors, potential ligands could include small molecules relevant to the avian ecological niche, such as food-related compounds or conspecific cues.

How can recombinant COR3 be used to develop novel biosensors?

Recombinant COR3, particularly the biotinylated versions produced through in vivo biotinylation in E. coli , could be utilized to develop biosensors for detecting specific odorants:

  • Surface immobilization strategies:

    • Biotinylated COR3 can be attached to streptavidin-coated surfaces

    • The receptor can be incorporated into nanodiscs or liposomes to maintain native conformation

  • Detection methods:

    • Surface plasmon resonance (SPR) to detect ligand binding

    • Quartz crystal microbalance (QCM) for label-free detection

    • Fluorescence-based assays using conformationally sensitive fluorophores

  • Integration with microfluidic or electronic systems:

    • Field-effect transistor-based biosensors

    • Microelectrode arrays for measuring receptor activation

These biosensors could have applications in environmental monitoring, food quality assessment, or basic research on olfactory ligand specificity.

What are the implications of COR3 expression outside the olfactory epithelium?

The observation that COR3 is expressed in cells along the olfactory nerve from the placode to the anterior telencephalon during early developmental stages (before synaptogenesis) raises intriguing questions about its potential non-olfactory functions:

  • Potential developmental roles:

    • Guidance cues for axon pathfinding

    • Cell migration signals

    • Cell-cell recognition during development

  • Methodological approaches to investigate these non-canonical functions:

    • Conditional knockout models specific to non-olfactory expressing cells

    • Ex vivo explant cultures to examine the effects on nerve development

    • Time-lapse imaging of fluorescently labeled cells expressing COR3

  • Comparison with ectopic expression of other olfactory receptors:

    • Similar to how some mammalian olfactory receptors have been found in non-olfactory tissues (e.g., kidney )

    • May suggest evolutionary conservation of dual functionality

Understanding these potential non-olfactory functions could provide insights into the evolutionary history of these receptors and their repurposing for different physiological roles.

What are the most promising future research directions for COR3?

Several promising research directions could advance our understanding of COR3:

  • Ligand identification:

    • Systematic screening of potential odorants using heterologous expression systems

    • In vivo functional studies to correlate receptor activation with behavioral responses

  • Structural studies:

    • Cryo-EM or X-ray crystallography of the full-length receptor

    • Structure-function analysis through site-directed mutagenesis

  • Developmental biology:

    • Further characterization of COR3-expressing cells outside the olfactory epithelium

    • Investigation of regulatory mechanisms ensuring the one neuron-one receptor rule

  • Comparative studies:

    • Analysis of COR3 homologs across avian species to understand evolutionary adaptations

    • Comparison with mammalian counterparts to identify conserved and divergent features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.