Recombinant Chicken Oligosaccharyltransferase complex subunit OSTC (OSTC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chicken Oligosaccharyltransferase Complex Subunit OSTC (OSTC)

Recombinant Chicken Oligosaccharyltransferase Complex Subunit OSTC (OSTC) refers to a synthetically produced version of the OSTC protein, which is a subunit of the oligosaccharyltransferase (OST) complex in chickens . The OST complex is crucial for N-glycosylation, a process where glycans are attached to proteins, influencing their folding, stability, and function . Recombinant OSTC is typically produced in a host organism like E. coli and is used in research to study the structure, function, and interactions of the OST complex .

Basic Information

CategoryDescription
NameRecombinant Full Length Chicken Oligosaccharyltransferase Complex Subunit Ostc(Ostc) Protein, His-Tagged
Source OrganismGallus gallus (Chicken)
Accession NumberQ5ZJR3
Amino Acid Sequence1-149
TagN-terminal His tag
Expression HostE. coli

Function and Significance

  • N-Glycosylation: OSTC is a vital component of the oligosaccharyltransferase (OST) complex, responsible for catalyzing the transfer of pre-assembled glycan structures to asparagine residues on nascent polypeptide chains . This N-glycosylation is essential for protein folding, stability, and interactions .

  • Protein Quality Control: The OST complex, including OSTC, plays a role in the quality control of newly synthesized proteins within the endoplasmic reticulum (ER) .

  • Research Applications: Recombinant OSTC is used in biochemical assays, structural studies, and drug discovery efforts targeting glycosylation pathways .

Production and Characterization of Recombinant Chicken Growth Hormone

  • Recombinant chicken growth hormone (rcGH) can be produced and characterized to study its metabolic effects on chickens .

  • rcGH and pituitary-derived cGHs are identical, except for an N-terminal methionyl group from the bacterial expression system .

  • In hypophysectomized rat growth assays, recombinant and pituitary materials exhibit the same specific bioactivity .

  • Administering rcGH to chickens can lead to significant metabolic effects; plasma levels of insulin and triglycerides were significantly elevated by rcGH in 24-day-old females, but not in males .

Recombinant Vaccines in Chickens

  • Recombinant vaccines utilizing the OMP36 gene of Pasteurella multocida have shown promise in providing protection against pasteurellosis in chickens .

  • Recombinant vaccines can stimulate higher antibody levels in chickens compared to commercial vaccines .

  • These vaccines can provide excellent homologous and cross-protection against specific serotypes of P. multocida .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
OSTC; RCJMB04_16e19; Oligosaccharyltransferase complex subunit OSTC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
OSTC
Target Protein Sequence
METLFRLPFAVLECPNIKLKRPGWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVSVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function
This protein is a subunit of the oligosaccharyltransferase (OST) complex. The OST complex catalyzes the transfer of a specific glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in N-glycosylation. N-glycosylation is a co-translational process, and the OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity.
Database Links

KEGG: gga:422525

UniGene: Gga.4121

Protein Families
OSTC family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Chicken OSTC and what is its role in the oligosaccharyltransferase complex?

Chicken OSTC (also known as DC2) is a non-catalytic subunit of the oligosaccharyltransferase (OST) complex that plays a crucial role in N-linked glycosylation. It is specifically a component of the STT3A-containing form of the OST complex that catalyzes the initial transfer of defined glycans (Glc3Man9GlcNAc2) from dolichol-pyrophosphate to asparagine residues within the Asn-X-Ser/Thr consensus motif in nascent polypeptide chains .

The protein contributes to dolichyl-diphosphooligosaccharide-protein glycotransferase activity and engages in protein binding interactions. N-glycosylation mediated by this complex occurs cotranslationally as the OST complex associates with the Sec61 complex at the channel-forming translocon complex that facilitates protein translocation across the endoplasmic reticulum . OSTC is required for maximal enzymatic activity of the complex, working in concert with other subunits to ensure efficient N-glycosylation.

How does the STT3A-containing OST complex with OSTC differ functionally from other OST isoforms?

The STT3A-containing OST complex (which includes OSTC) specializes in cotranslational glycosylation, modifying nascent polypeptides as they enter the endoplasmic reticulum lumen . This differs from the STT3B-containing complex, which has distinct complementary roles:

OST Complex TypePrimary FunctionTemporal ActionSpecial Capabilities
STT3A-containing (with OSTC)Primary cotranslational glycosylationDuring translationEfficient processing of most sequons during initial protein synthesis
STT3B-containingComplementary glycosylationBoth co- and post-translationalEfficient glycosylation of N-terminal sites near signal sequences and posttranslational modification of skipped sites in unfolded proteins

This functional division allows sequential scanning of polypeptides for acceptor sites, maximizing glycosylation efficiency through complementary activity . Researchers should consider these distinct roles when studying N-glycosylation mechanisms or developing expression systems.

What are the key identifiers and characteristics of recombinant Chicken OSTC?

When working with recombinant Chicken OSTC, researchers should be familiar with these key identifiers:

AttributeDetails
Official SymbolOSTC
Gene ID422525
Protein RefSeqNP_001006442
UniProt IDQ5ZJR3
KEGGgga:422525
UniGeneGga.4121
SynonymsDC2, oligosaccharyltransferase complex subunit
Typical Purity≥85% (SDS-PAGE)
Expression SystemCell-free expression (common)

The recombinant protein interacts with STT3A-containing OST complexes and associates with the Sec61 translocon channel, facilitating co-translational glycosylation of nascent polypeptides . Commercial preparations typically achieve ≥85% purity as determined by SDS-PAGE analysis .

What methods can be used to optimize expression of chicken OSTC in heterologous systems?

Optimizing chicken OSTC expression requires careful consideration of promoter systems and expression conditions. Based on research with similar oviduct-expressed proteins, several approaches have shown promise:

Recombinant Promoter Systems:
Reconstructed promoters linking regulatory regions of ovalbumin and other oviduct-specific genes can significantly enhance expression. A study developing recombinant chicken promoters found that:

  • Linking the 2.8-kb ovalbumin promoter with putative enhancer fragments from genes like ovotransferrin (TF) and ovomucin alpha subunit (OVOA) at the 5'-flanking region

  • Incorporating basal promoter fragments from genes such as lysozyme (pLYZ) and ovomucoid (pOVM) at the 3'-flanking region of the 1.6-kb ovalbumin estrogen-responsive enhancer element (ERE)

These recombinant promoters demonstrated 2.1- to 19.5-fold higher luciferase activity compared to the reconstructed ovalbumin promoter in chicken oviduct cells . Similar design principles could be applied to optimize OSTC expression.

For evaluation of promoter activity, dual luciferase assays in relevant cell types (human and chicken somatic cells, LMH/2A cells with estrogen treatment, and cultured primary chicken oviduct cells) provide reliable quantitative data on expression efficiency .

How can researchers evaluate the functional activity of recombinant chicken OSTC in N-glycosylation assays?

Assessing the functional activity of recombinant chicken OSTC requires experimental approaches that measure its contribution to OST complex activity:

Reconstitution Assays:

  • Co-express chicken OSTC with other OST complex components in an appropriate expression system

  • Prepare microsomal membranes containing the reconstituted complex

  • Conduct in vitro glycosylation assays using fluorescently labeled peptide substrates containing the Asn-X-Ser/Thr sequon

  • Measure glycopeptide formation by HPLC or mass spectrometry

Cross-Species Compatibility Testing:
Research has shown that co-expression of LmSTT3D (a protozoan OST subunit) with chicken OSTC enhances glycosylation site occupancy in plants, demonstrating cross-species compatibility. Similar approaches can assess functional integration:

  • Express chicken OSTC alongside OST subunits from various species

  • Evaluate glycosylation efficiency using model substrate proteins

  • Compare glycosylation site occupancy through mass spectrometry analysis

Substrate Promiscuity Evaluation:
Chicken OSTC homologs (e.g., C. jejuni PglB) exhibit substrate promiscuity, transferring diverse bacterial glycans to recombinant proteins in cell-free assays. To evaluate this characteristic:

  • Set up cell-free glycosylation reactions with purified components

  • Provide diverse glycan donors and acceptor peptides/proteins

  • Analyze glycan transfer efficiency and specificity by mass spectrometry

  • Compare kinetic parameters with other OST complex variants

What approaches can be used to study OSTC's interactions with other OST complex components?

Understanding OSTC's interactions within the OST complex requires sophisticated protein-protein interaction methodologies:

Co-immunoprecipitation Studies:

  • Express tagged versions of chicken OSTC and potential binding partners in appropriate cell lines

  • Perform pulldown assays using antibodies against the tags

  • Analyze precipitated proteins by SDS-PAGE and western blotting or mass spectrometry

  • Quantify interaction strengths under various conditions

Crosslinking Mass Spectrometry:

  • Treat intact OST complexes with chemical crosslinkers of different spacer lengths

  • Digest crosslinked complexes and analyze by LC-MS/MS

  • Identify crosslinked peptides using specialized software

  • Map interaction surfaces between OSTC and other subunits

Current evidence indicates that OSTC associates specifically with STT3A, DC2, and KCP2 to regulate substrate specificity and complex stability. These interactions are critical for the function of the STT3A-containing OST complex responsible for cotranslational glycosylation.

How does OSTC contribute to the sequential scanning model of N-glycosylation?

The sequential scanning model proposes that OST isoforms cooperate to maximize glycosylation efficiency through complementary activities. Investigating OSTC's role in this process requires specialized approaches:

siRNA Knockdown Studies:
Research has demonstrated that OST isoforms with different catalytic subunits (STT3A versus STT3B) have distinct enzymatic properties and act sequentially . To study OSTC's specific contribution:

  • Perform isoform-specific knockdowns of OSTC using siRNA in appropriate cell lines

  • Express reporter glycoproteins with multiple glycosylation sites

  • Analyze site occupancy using mass spectrometry or specific glycan-detecting antibodies

  • Compare glycosylation efficiency at sites with different properties (N-terminal, internal, C-terminal)

Pulse-Chase Analysis:

  • Perform pulse-chase labeling of nascent glycoproteins in cells with normal or depleted OSTC levels

  • Immunoprecipitate specific glycoproteins at different chase times

  • Analyze glycosylation status using endoglycosidase treatments and SDS-PAGE

  • Determine the timing of glycosylation at different sites

Evidence indicates that the STT3A-OSTC complex primarily mediates cotranslational glycosylation of nascent polypeptides, while the STT3B complex can function both co- and post-translationally, especially for sites near signal sequences or those initially skipped .

How can researchers resolve contradictory results when studying chicken OSTC function?

When facing contradictory experimental results regarding OSTC function, systematic analytical approaches can help resolve discrepancies:

Contradiction Analysis Framework:

  • Clearly define the specific contradiction (e.g., "Study A shows OSTC enhances glycosylation of protein X, while Study B shows no effect")

  • Systematically compare experimental conditions including:

    • Cell lines/expression systems used

    • OSTC constructs (full-length vs. partial, wild-type vs. mutant)

    • Substrate proteins and their folding states

    • Analytical methods employed

    • Presence of STT3A vs. STT3B complexes

Experimental Validation:
When facing contradictory literature, researchers should:

  • Design experiments that test multiple hypotheses simultaneously with appropriate controls

  • Vary a single parameter at a time to identify condition-dependent effects

  • Use complementary assay methods to verify results from multiple angles

  • Consider context-specific effects (e.g., cell type, protein substrate structure)

For example, when evaluating contradictory reports about OSTC's role in glycosylation of specific substrates, researchers should state a clear basis for contradiction analysis, such as "Study A reports that OSTC affects glycosylation sites adjacent to transmembrane domains, while Study B claims no such effect" . This approach helps isolate the source of discrepancies.

What are the emerging applications of recombinant chicken OSTC in glycoengineering?

Recombinant chicken OSTC has several promising applications in glycoengineering:

Enhancing Biopharmaceutical Production:

  • Co-expression of chicken OSTC with appropriate STT3A complexes can enhance glycosylation efficiency of recombinant monoclonal antibodies and other therapeutic glycoproteins

  • Optimizing N-glycosylation site occupancy improves protein stability, half-life, and biological activity

Vaccine Development:

  • Improved glycosylation of recombinant glycoprotein antigens through enhanced OST activity

  • Production of uniformly glycosylated immunogens with defined glycan structures

Specialized Expression Systems:
Virus injection into EGK-X embryos represents a well-defined approach in avian transgenesis. When combined with optimized promoters, this system can enable tissue-specific expression of OSTC and other glycosylation-related proteins . Researchers have developed recombinant chicken promoters that link regulatory regions of ovalbumin and other oviduct-specific genes, which could potentially be used for efficient expression of OSTC in transgenic chickens .

What role might OSTC play in cancer research and therapeutic development?

OSTC has emerging significance in cancer biology and therapeutic development:

Cancer Progression Mechanisms:
OSTC subunits are upregulated in tumor cells, promoting survival and drug resistance. Research opportunities include:

  • Analyzing OSTC expression levels across cancer types

  • Correlating OSTC expression with glycosylation patterns of oncogenic proteins

  • Investigating how altered N-glycosylation affects cancer cell signaling pathways

Therapeutic Targeting:

  • Developing OSTC inhibitors as potential therapeutic agents for drug-resistant tumors

  • Evaluating how OSTC inhibition affects glycosylation-dependent oncogenic signaling

  • Combining OSTC modulation with existing cancer therapies to overcome resistance mechanisms

This research direction is supported by findings that OSTC may be involved in N-glycosylation of proteins like APP (amyloid-beta precursor protein) and can modulate gamma-secretase cleavage by enhancing endoproteolysis of PSEN1 , suggesting broader roles in protein processing pathways relevant to disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.