Recombinant Chicken P2Y purinoceptor 1 (P2RY1)

Shipped with Ice Packs
In Stock

Description

Calcium Mobilization and Second Messengers

Recombinant chicken P2Y1 activates Gq-mediated signaling pathways upon binding ATP or ADP. In cultured chick myotubes, receptor activation triggers:

  • Inositol Phosphate Accumulation: A hallmark of phospholipase C (PLC) activation, leading to IP3-mediated calcium release from intracellular stores .

  • Intracellular Ca²⁺ Mobilization: Measured via fluorescent indicators (e.g., Fura-2), showing rapid transient increases in cytosolic calcium .

  • Proton Efflux: A newly identified response linked to receptor activation, potentially modulating local pH at synaptic sites .

Regulation of Synaptic Proteins

P2Y1 activation induces transcriptional upregulation of postsynaptic proteins critical for neuromuscular function:

  • AChE Expression: Agonists like 2-MeSATP increase AChE catalytic subunit mRNA and protein levels in myotubes, though enzymatic activity remains unchanged .

  • AChR Synthesis: The AChR α-subunit promoter is activated by P2Y1 signaling, with mRNA levels rising >20-fold in denervated muscle upon reinnervation .

Table 2: Functional Roles of Recombinant Chicken P2Y1

PathwayEffectAgonists/Antagonists
PLC-IP3-Ca²⁺↑ Inositol phosphates, Ca²⁺ mobilization2-MeSATP, ADP (EC₅₀ = 50 μM)
AChE/AChR Transcription↑ mRNA and protein levels2-MeSADP (P2Y1-specific agonist)
Proton TransportExtracellular acidificationBlocked by A3P5P (antagonist)

Ontogenetic Expression Patterns

  • Embryonic Development: P2Y1 mRNA is undetectable in embryonic day 7 (E7) chick spinal cord but rises sharply by E10, peaking at hatching .

  • Postnatal Maturation: Receptor protein localizes to neuromuscular junctions (NMJs) 3 weeks post-hatching, coinciding with synaptic maturation .

  • Adult Expression: Highest mRNA levels in adult muscle (3-fold higher than spinal cord), with protein restricted to NMJs in chicken, rat, and Xenopus .

Denervation and Reinnervation

  • Transcriptional Dynamics: Denervation reduces P2Y1 mRNA by 90% in chick and rat muscle within 2 days, recovering only after reinnervation .

  • Contrast with AChR: While AChR mRNA surges post-denervation (compensatory plasticity), P2Y1 expression depends strictly on motor neuron contact .

Junctional Colocalization

In adult muscle, P2Y1 receptors colocalize with AChRs at NMJs:

  • Chick: Colocalization begins at postnatal day 20 (P20), absent in embryos .

  • Rat/Xenopus: Evolutionary conservation of junctional localization highlights its role in synaptic maintenance .

Motor Neuron Expression

P2Y1 mRNA and protein are abundant in chick spinal motor neurons, suggesting potential anterograde transport to presynaptic terminals .

Recombinant Production and Antibody Generation

  • Expression Construct: The C-terminal domain (residues 320–362) was fused to thioredoxin in pET32, yielding insoluble inclusion bodies purified under denaturing conditions .

  • Antibody Specificity: Affinity-purified polyclonal antibodies show no cross-reactivity with other P2Y subtypes, validated via peptide block experiments .

Pharmacological Profiling

  • Agonist Specificity: 2-MeSADP > ATP > ADP (EC₅₀ = 0.1–1 μM) .

  • Antagonist Efficacy: A3P5P (100 μM) blocks 80–90% of calcium responses .

Synaptic Maintenance Mechanisms

P2Y1 activation by neuronally released ATP may sustain postsynaptic gene expression, ensuring NMJ integrity. This contrasts with transient P2X receptor roles in development .

Therapeutic Potential

Modulating P2Y1 signaling could address neuromuscular pathologies characterized by AChR/AChE deficiency, though in vivo studies remain pending.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own applications.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize fulfilling your request.
Synonyms
P2RY1; P2Y purinoceptor 1; P2Y1; ATP receptor; Purinergic receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MTEALISAALNGTQPELLAGGWAAGNATTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT SL
Uniprot No.

Target Background

Function
This receptor binds to extracellular adenine nucleotides such as ADP. In platelets, ADP binding triggers the mobilization of intracellular calcium ions through activation of phospholipase C, leading to alterations in platelet shape and ultimately, platelet aggregation.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain, spinal cord, gastrointestinal tract, spleen and leg muscle. Is not detected in the heart, liver, stomach, lung and kidney.

Q&A

What is the molecular identity of chicken P2RY1?

Chicken P2RY1 is a G-protein-coupled receptor that responds to adenine nucleotides. It was initially cloned from chick brain and characterized as a metabotropic ATP receptor. The receptor protein has an apparent molecular mass of approximately 50 kDa when analyzed by electrophoretic methods . The chicken P2RY1 mRNA transcript is about 3.2 kb in length, detected in both muscle and neuronal tissues . The C-terminal portion of chicken P2RY1 (residues 320-362) shows approximately 86% sequence identity with the corresponding region in rat P2RY1, indicating high evolutionary conservation of functional domains .

How does P2RY1 expression change during chicken development?

P2RY1 expression follows a distinct developmental pattern in chicken tissues. In embryonic spinal cord, P2RY1 mRNA is barely detectable at embryonic day 7 (E7) but increases significantly from E10 until hatching . Post-hatching, the expression initially decreases but subsequently increases considerably up to approximately day 11 post-hatch and remains high in adulthood . In skeletal muscle, P2RY1 follows a roughly similar profile, with expression being highest in adult tissue . Quantitatively, muscle contains approximately threefold higher expression of P2RY1 receptor mRNA than spinal cord at all developmental stages examined .

What are the standard methods for detecting chicken P2RY1?

Several complementary approaches can be used to detect chicken P2RY1:

RNA Detection:

  • Northern blotting using specific probes against the 3.2 kb P2RY1 transcript

  • Reverse transcription PCR with primers specific to chicken P2RY1 sequence

Protein Detection:

  • Western blotting using antibodies directed against the C-terminal portion of the chicken P2RY1 receptor

  • Immunohistochemistry on tissue sections (typically 20 μm) using anti-P2RY1 antibodies with fluorescein-conjugated secondary antibodies

Functional Analysis:

  • Measurement of intracellular calcium mobilization

  • Inositol phosphate accumulation assays

  • Microphysiometry to detect extracellular pH changes during receptor activation

What is the subcellular localization of P2RY1 in chicken muscles?

In adult chicken muscle, P2RY1 receptors demonstrate distinct localization at neuromuscular junctions, as evidenced by colocalization with acetylcholine receptors (AChRs) . This localization can be visualized by double-labeling techniques using anti-P2RY1 antibodies and tetramethylrhodamine-conjugated α-bungarotoxin (which binds specifically to AChRs) . Interestingly, this junctional localization is not present during embryonic development, as embryonic muscles (E10-E19) show no significant colocalization of P2RY1 with AChRs . The junctional localization develops gradually after hatching, becoming prominent from post-hatch day 20 (P20) to adulthood . Weak extra-junctional staining can still be observed in some areas of adult muscle, suggesting a small population of non-synaptic P2RY1 receptors .

How is P2RY1 distributed in the chicken nervous system?

P2RY1 is prominently expressed in the spinal cord, particularly in motor neurons located in the ventral horn . Immunohistochemical analysis reveals strong staining in motor neuron cell bodies, with the receptor protein distributed both in the region of the somatic cell membranes and in the cytoplasm . This distribution pattern suggests that P2RY1 may have both somatic functions in motor neurons and could potentially be transported to nerve terminals at neuromuscular junctions, though higher-resolution electron microscopic studies would be needed to confirm the latter .

How does P2RY1 localization compare across vertebrate species?

The junctional localization of P2RY1 appears to be conserved across vertebrate species. Studies have demonstrated that P2RY1 receptors are colocalized with AChRs at neuromuscular junctions not only in chicken but also in adult rat and Xenopus muscles . This cross-species conservation suggests a fundamental role for P2RY1 in neuromuscular transmission across vertebrates . The antibody raised against chicken P2RY1 C-terminal region cross-reacts with rat and Xenopus P2RY1, consistent with the high sequence homology (86% identity) in this region between chicken and rat P2RY1 receptors .

What are the optimal expression systems for recombinant chicken P2RY1?

Several expression systems have been successfully used for recombinant chicken P2RY1:

Mammalian Cell Lines:

  • COS-7 cells (simian kidney endothelial cells) provide efficient expression of functional P2RY1 receptors with proper post-translational modifications and membrane targeting

  • The receptor shows high expression levels in transfected COS-7 cell membranes (Bmax = 7.9 ± 2 pmol/mg protein)

Amphibian Oocytes:

  • Xenopus oocytes have been successfully used to express functional chicken P2RY1 receptors

  • This system is particularly useful for electrophysiological studies of receptor-activated currents

Prokaryotic Systems:

  • E. coli strain BL21 (Lys S) has been used to express fusion proteins containing the C-terminal domain (residues 320-362) of chicken P2RY1 for antibody production

  • This approach is suitable for producing protein fragments for immunization but not for expressing the full-length functional receptor

What vector systems are recommended for chicken P2RY1 expression?

For recombinant expression of chicken P2RY1, several vector systems have been documented:

Eukaryotic Expression:

  • Standard mammalian expression vectors with strong promoters (e.g., CMV) are effective for COS-7 cell transfection

Prokaryotic Expression:

  • The pET32 vector (Novagen) has been successfully used to create thioredoxin fusion proteins containing chicken P2RY1 C-terminal fragments in E. coli

  • This system allows for affinity purification of the fusion protein for subsequent antibody production

Researchers should select the appropriate vector system based on their specific experimental goals, whether functional studies (mammalian expression) or protein production for antibodies (prokaryotic expression).

What are the pharmacological properties of recombinant chicken P2RY1?

Recombinant chicken P2RY1 displays distinct pharmacological properties in heterologous expression systems:

Agonist Potency Profile:
The order of potency for agonists activating chicken P2RY1 is:

  • 2-MeSADP ≥ 2-MeSATP > ATP > ADP

  • Adenosine is inactive, confirming specificity for adenine nucleotides

  • UTP and UDP have negligible activity at chicken P2RY1

  • αβ-meATP (a P2X receptor-selective agonist) does not activate P2RY1

Antagonist Sensitivity:
The following antagonists effectively block chicken P2RY1 responses:

  • Adenosine 3',5'-bismonophosphate (A3P5P) - P2RY1-specific antagonist

  • Pyridoxal-phosphate-6-azophenyl-2',4'-disulfonic acid (PPADS)

  • Reactive blue 2 (RB-2)

  • Suramin

These pharmacological properties allow for specific activation and inhibition of P2RY1-mediated responses in experimental settings.

What signaling pathways are activated by chicken P2RY1?

Chicken P2RY1 couples to G-proteins and activates several downstream signaling pathways:

Primary Signaling Pathway:

  • Activation of phospholipase C

  • Stimulation of inositol phosphate accumulation

  • Mobilization of intracellular calcium

The application of P2RY1 agonists (2-MeSATP, 2-MeSADP, ATP) to cultured chick myotubes or COS-7 cells expressing recombinant P2RY1 significantly increases intracellular inositol phosphate levels . The concentration-response curve for ATP is biphasic, suggesting possible involvement of multiple receptor subtypes or signaling mechanisms .

Secondary Effects:

  • Altered extracellular pH (detected by microphysiometry)

  • Activation of gene expression for acetylcholinesterase (AChE) and acetylcholine receptor (AChR) α-subunit in myotubes

How can P2RY1 function be measured in recombinant systems?

Several complementary assays can effectively measure P2RY1 function:

Inositol Phosphate Accumulation:

  • Cells are pre-labeled with [³H]inositol

  • Following agonist stimulation, accumulated inositol phosphates are extracted and quantified by scintillation counting

  • This provides a direct measure of PLC activation downstream of P2RY1

Calcium Mobilization:

  • Fluorescent calcium indicators (e.g., Fura-2, Fluo-4)

  • Real-time measurement of intracellular calcium concentration changes upon receptor activation

Microphysiometry:

  • Sensitive detection of extracellular pH changes during agonist application

  • In chick myotubes, ATP, 2-MeSATP, and 2-MeSADP induce significant changes in H⁺ output

  • These pH changes are blocked by P2 antagonists

Reporter Gene Assays:

  • Promoter-reporter constructs for AChE and AChR genes can be used to measure P2RY1-mediated gene activation

  • These constructs are activated when P2RY1 receptors are stimulated by specific agonists or overexpressed in cultured myotubes

How does P2RY1 expression respond to denervation and reinnervation?

P2RY1 expression shows distinct responses to neural input alterations:

Denervation Effects:

  • Denervation or crush of the motor nerve in chicken or rat causes up to 90% decrease in muscle P2RY1 transcript levels

  • This is in stark contrast to AChR mRNA, which greatly increases following denervation

Reinnervation Response:

  • P2RY1 transcript levels are restored upon nerve regeneration

  • This restoration parallels the recovery of neuromuscular function

These findings indicate that P2RY1 expression is positively regulated by neural input, unlike AChR which is negatively regulated, suggesting distinct regulatory mechanisms and potentially complementary roles in neuromuscular synapse maintenance.

What is the relationship between P2RY1 and synaptic gene expression?

P2RY1 activation regulates the expression of key synaptic proteins in muscle cells:

Effects on AChE and AChR Expression:

  • P2RY1 activation by ATP or specific agonists induces mRNA expression of AChE catalytic subunit and AChR α-subunit in cultured myotubes

  • This induction is blocked by P2RY1-specific antagonists

  • Overexpression of P2RY1 in myotubes enhances this effect, stimulating AChE protein production to several times the control level

Post-transcriptional Regulation:

  • While P2RY1 activation increases AChE mRNA and protein levels, interestingly, it does not significantly affect AChE enzymatic activity

  • This suggests additional post-translational regulatory mechanisms

These findings indicate that P2RY1 functions as a mediator in synapse-organizing processes, potentially translating neural activity (via ATP release) into muscle gene expression changes.

What are the challenges in distinguishing P2RY1 effects from other P2Y receptors?

Researchers face several challenges when isolating P2RY1-specific effects:

Overlapping Pharmacology:

  • Multiple P2Y receptor subtypes may be present in the same tissue

  • UTP responses in muscle cells suggest the presence of P2Y2 and/or P2Y4 receptors alongside P2RY1

  • The higher activity of ATP relative to 2-MeSATP and 2-MeSADP in some assays indicates contributions from other P2Y subtypes

Technical Approaches to Overcome These Challenges:

  • Use of subtype-selective agonists and antagonists:

    • 2-MeSADP as a relatively selective P2RY1 agonist

    • A3P5P as a P2RY1-selective antagonist

    • Lack of response to UTP/UDP as negative indicators for P2RY1 involvement

  • Molecular approaches:

    • Overexpression of recombinant P2RY1 to amplify specific responses

    • Use of specific antibodies for protein detection and localization

    • Northern blotting to confirm absence of other P2Y subtypes (e.g., P2Y3, P2Y5 in chick muscle)

What are the recommended protocols for generating antibodies against chicken P2RY1?

Generation of specific antibodies against chicken P2RY1 can be accomplished through the following protocol:

Immunogen Design:

  • Target the C-terminal portion of chicken P2RY1 (residues 320-362)

  • This region has no homology with other P2Y receptors, ensuring specificity

  • Express as a fusion protein with thioredoxin using the pET32 vector in E. coli BL21 (Lys S) strain

Immunization and Antibody Purification:

  • Immunize rabbits three times with the purified fusion protein

  • Purify antibodies by protein-A affinity chromatography (High Trap column)

Validation Methods:

  • Western blotting against recombinant P2RY1 (should detect a ~50 kDa band)

  • Immunofluorescence on muscle sections with peptide blocking controls

  • Double-labeling with established synaptic markers like α-bungarotoxin

This approach yields antibodies suitable for immunohistochemistry at concentrations of approximately 20 μg/ml.

What experimental design best demonstrates P2RY1-mediated gene regulation?

To demonstrate P2RY1-mediated gene regulation in muscle cells, the following experimental approach is recommended:

Cell Culture System:

  • Primary cultures of chick myotubes or established muscle cell lines

  • Transfection with expression vectors for chicken P2RY1 receptor and/or reporter constructs

Experimental Conditions:

  • Control groups:

    • Untransfected cells with vehicle treatment

    • Cells transfected with empty vector

    • Cells treated with non-P2RY1 agonists (e.g., UTP)

  • Experimental groups:

    • Cells treated with P2RY1-selective agonists (2-MeSATP, 2-MeSADP)

    • Cells overexpressing P2RY1 and treated with agonists

    • Cells treated with agonists in presence of P2RY1 antagonists (A3P5P)

Readout Methods:

  • RT-PCR or Northern blotting for mRNA levels of target genes (AChE, AChR)

  • Western blotting for protein levels

  • Promoter-reporter constructs (luciferase or β-galactosidase) driven by AChE or AChR promoters

  • Enzymatic activity assays (e.g., AChE activity)

This comprehensive approach allows clear demonstration of P2RY1-specific effects on gene expression while controlling for non-specific effects.

How does chicken P2RY1 compare structurally and functionally to mammalian orthologs?

Chicken P2RY1 shares significant structural and functional similarities with mammalian orthologs:

Sequence Homology:

  • The C-terminal region (residues 320-362) of chicken P2RY1 shows 86% identity with the corresponding region in rat P2RY1

  • This high conservation suggests similar functional domains across species

Cross-species Recognition:

  • Antibodies raised against chicken P2RY1 C-terminal region cross-react with rat and Xenopus P2RY1 receptors

Functional Conservation:

  • Similar junctional localization patterns at neuromuscular junctions across chicken, rat, and Xenopus

  • Comparable pharmacological profiles with responses to adenine nucleotides

These similarities make chicken P2RY1 a valuable model for understanding general principles of purinergic signaling across vertebrate species.

What developmental differences exist in P2RY1 expression between avian and mammalian systems?

Notable developmental patterns differentiate avian from mammalian P2RY1 expression:

Temporal Expression Patterns:

  • In chicken, P2RY1 receptor mRNA is abundant before hatching, decreases initially post-hatch, and increases again to high levels in the adult

  • This contrasts with P2X receptors, which are prominent in embryonic stages but decline by E17 in chicken

Synaptic Localization Development:

  • In chicken, P2RY1 receptors are not colocalized with AChRs during embryonic development (E10-E19)

  • Colocalization develops gradually after hatching, becoming prominent from P20 to adulthood

  • This developmental localization pattern may differ in timing from mammalian systems

Functional Significance:

  • The developmental regulation of P2RY1 in chicken muscles (increasing with maturity) is the opposite of P2X receptors (decreasing with maturity)

  • This suggests complementary roles during development, with P2X predominating in embryonic stages and P2RY1 taking over in mature neuromuscular junctions

What unresolved questions remain regarding P2RY1 trafficking and localization?

Several important questions about P2RY1 trafficking and localization remain to be addressed:

Pre- vs. Post-synaptic Localization:

  • Current light microscopy studies cannot definitively distinguish between pre- and post-synaptic localization of P2RY1 at neuromuscular junctions

  • Electron microscopy immunolocalization would be needed to resolve this question

Trafficking Mechanisms:

  • The molecular mechanisms controlling the developmental shift in P2RY1 localization to neuromuscular junctions after hatching remain undefined

  • The potential role of neural activity in this process needs further investigation

Motor Neuron Expression:

  • While P2RY1 is expressed in motor neuron cell bodies, it remains unclear whether the receptor is trafficked to nerve terminals

  • If so, what are the functional implications of presynaptic P2RY1 receptors?

Future studies using higher-resolution imaging techniques and selective pre/post-synaptic manipulations would help address these questions.

How might recombinant P2RY1 be utilized in therapeutic applications?

Recombinant P2RY1 research has potential therapeutic applications in several areas:

Neuromuscular Junction Disorders:

  • Understanding P2RY1's role in maintaining synaptic gene expression (AChE, AChR) could inform treatments for neuromuscular disorders

  • Selective P2RY1 agonists might promote synaptic maintenance in conditions with synaptic degeneration

Denervation Atrophy:

  • The dramatic decrease in P2RY1 expression after denervation suggests potential applications in preventing muscle atrophy

  • Maintaining P2RY1 signaling might partially compensate for loss of neural input

Synaptic Regeneration:

  • P2RY1's role in synapse organization suggests potential applications in promoting reinnervation or synaptic regeneration

  • Recombinant P2RY1 or selective agonists might enhance synaptic reconnection following nerve injury

Continued research on the molecular mechanisms underlying P2RY1's effects on synaptic gene expression and maintenance will be crucial for developing these potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.