Recombinant Chicken P2Y purinoceptor 8 (P2RY8)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chicken P2Y Purinoceptor 8 (P2RY8)

Recombinant Chicken P2Y purinoceptor 8 (P2RY8) is a synthetic protein derived from the P2RY8 gene in chickens. It belongs to the purinergic receptor family of G-protein-coupled receptors (GPCRs) and is activated by adenosine and uridine nucleotides. P2RY8 plays critical roles in cellular signaling pathways, including adenylyl cyclase activation, phospholipase C signaling, and extracellular signal-regulated kinase (ERK) pathways . In chickens, P2RY8 has been implicated in immune responses and disease pathogenesis, particularly in Marek’s disease (MD), a viral-induced lymphoma .

Role in Marek’s Disease

P2RY8 expression is dynamically regulated during Marek’s disease virus (MDV) infection. Studies in White Leghorn (WL) and Plymouth Rock (PC) chicken lines reveal:

  • Increased Expression in Susceptible PC Chickens: P2RY8 expression peaks in MDV-infected and diseased PC chickens, particularly in the liver, suggesting a role in disease progression .

  • Tissue-Specific Responses: P2RY8 levels rise in the lungs of WL chickens during infection but decline in diseased stages, highlighting divergent pathogenic mechanisms between resistant and susceptible lines .

  • Oncogenic Potential: Elevated P2RY8 expression correlates with leukemogenesis in chickens, mirroring its role in human B-cell acute lymphoblastic leukemia (B-ALL) .

Functional Signaling Pathways

P2RY8 activates downstream effectors such as:

  1. ERK and CREB: Mediates cell proliferation and survival .

  2. Phospholipase C (PLC): Triggers calcium mobilization and cellular migration .

  3. Adenylyl Cyclase: Regulates cAMP production, influencing immune cell function .

Applications in Research and Disease Modeling

Recombinant Chicken P2RY8 is utilized to study:

  1. MDV-Host Interactions: Investigating how P2RY8 modulates viral replication and lymphoma development .

  2. Signaling Mechanisms: Mapping receptor-ligand interactions and downstream effector activation .

  3. Therapeutic Targeting: Exploring P2RY8 inhibitors for treating MD or P2RY8-driven cancers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
P2RY8; RCJMB04_29g19; P2Y purinoceptor 8; P2Y8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
Target Protein Sequence
MVKNGSHLDAETLAMLQNKAISITLPVVYTMVAIISIPGNFFSLWVLCWHIKPKTPSVIF MINLSITDLLLACCFPFQIFYHIQRNHWIFGKTLCSLVTVMFYSNMYSSILTMTCISIER YMGVVYPMKLIKWRRKRYALGACVIMWIFLLLAFYPLESTDLTYEVKELGIITCFDVLKW EMLPNFAAWVAFLLTLFVVLFLIPFIVTVGCYIGTIRKLIQTSSRYGNKQKTRSIYLAII VLSVFITCFAPNNFILLAHMIVRLFYEGSLYPAYKLTLCLSCLNNCIDPFIYYFASKEFY QKFMQVFRPKVPLSDSLETRRESLFSGRTMSVRSMSSGPMDGLEGVKICLQRQESVF
Uniprot No.

Target Background

Function
Probable G-protein-coupled receptor for purines.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of P2RY8 in chickens?

P2RY8 belongs to the G-protein-coupled receptor (GPCR) family, which constitutes the largest family of membrane-bound receptors. Like other GPCRs, P2RY8 possesses seven transmembrane alpha helices. It is specifically categorized as one of nine subtypes of purinergic receptors (P2RY1, P2RY2, P2RY4, P2RY6, P2RY8, P2RY11, P2RY12, P2RY13, and P2RY14) . Understanding this structural classification is essential for experimental design involving protein interactions and functional studies.

What are the primary activators of P2RY8?

P2RY8 functions as a transmembrane receptor that preferentially binds to and is activated by adenosine and uridine nucleotides . The receptor's activity is triggered upon binding to these nucleotides, resulting in the activation of the adenylyl cyclase intracellular signaling pathway. When designing experiments to study P2RY8 function, researchers should consider using adenosine and uridine nucleotides as positive controls for receptor activation.

Which downstream signaling pathways are activated by P2RY8?

Upon activation, P2RY8 triggers multiple downstream pathways. Primary among these is the adenylyl cyclase pathway, but P2RY8 also activates the extracellular signal-regulated kinases (ERK) signaling pathway and phospholipase C . For researchers studying signal transduction, identifying specific downstream components of the P2RY8 signaling pathway reveals that CREB and Elk-1 are activated by P2RY8 . Additionally, P2RY8 regulates the transcriptional activities of the serum response element (SRE), c-Fos, and c-Myc .

How does P2RY8 expression vary during immune responses in chickens?

P2RY8 expression demonstrates differential patterns during immune responses in chickens. Notably, P2Y purinergic receptors show variable expression in different chicken lines in response to Marek's disease virus (MDV) infection and disease progression . When designing studies examining immune function, researchers should account for this variability and consider tissue-specific expression patterns of the receptor.

What are the optimal methods for measuring P2RY8 expression in avian tissues?

For accurate quantification of P2RY8 expression in avian tissues, RT-qPCR with gene-specific primers is a recommended approach. This method has been successfully used to analyze expression patterns in whole lung lavage cells (WLLC) and liver tissue samples from chickens . When implementing this technique, researchers should:

  • Extract high-quality RNA from target tissues

  • Design primers specific to chicken P2RY8 to avoid cross-reactivity

  • Include appropriate housekeeping genes for normalization

  • Consider tissue-specific expression patterns when selecting samples

For protein-level detection, while specific P2RY8 ELISA kits might not be widely available, techniques used for related receptors like P2RY1 could be adapted. These assays typically demonstrate minimal cross-reactivity with analogues and show standard deviations less than 8% for repeated measurements .

How can researchers effectively create and validate P2RY8 mutants for functional studies?

To generate P2RY8 mutants for functional studies, researchers can employ site-directed mutagenesis protocols such as QuickChange (Agilent Technologies) . This approach allows for precise introduction of specific mutations to study structure-function relationships. For effective implementation:

  • Start with GFP-tagged or Flag-tagged P2RY8 vectors

  • Design primers incorporating the desired mutations

  • Validate mutants through sequencing

  • Insert the mutated cDNA into appropriate expression vectors (e.g., IRES-GFP containing PMIGII vector or IRES-Thy1.1 containing MSCV2.2 vector)

For functional validation, compare wild-type and mutant P2RY8 in assays examining:

  • AKT and ERK activation

  • Migration inhibition

  • Plasma cell differentiation

  • B cell selection processes

What experimental models are most appropriate for studying P2RY8 function in immune regulation?

Based on current research, several experimental models have proven valuable for investigating P2RY8 function in immune regulation:

  • In vitro B cell cultures: LPS-preactivated mouse B cells retrovirally transduced with wild-type or mutant P2RY8 can effectively demonstrate the receptor's role in restraining plasma cell formation .

  • Bone marrow chimeric mice: These models enable the examination of P2RY8 influence on plasma cell formation in vivo. This approach has revealed that cells expressing P2RY8 are underrepresented in spleen and bone marrow plasma cell compartments following immunization .

  • Transgenic mouse models: Models expressing DNA-reactive VH3H9 heavy chain (derived from lupus-prone mice) with P2RY8 expression have demonstrated the receptor's role in promoting tolerance in developing B cells .

For optimal model selection, researchers should consider:

  • The specific aspect of P2RY8 function being studied

  • The desired physiological context (development, immune response, disease state)

  • The availability of reagents specific to chicken or mammalian P2RY8

How is P2RY8 implicated in lymphoproliferative disorders in avian models?

P2RY8 plays a significant role in lymphoproliferative disorders, with research indicating that patients with high P2RY8 expression levels have a higher risk of leukemogenesis compared to those with lower expression levels . In investigative studies, researchers should:

  • Examine P2RY8 expression levels in normal vs. malignant lymphoid tissues

  • Assess the correlation between expression patterns and disease progression

  • Investigate the mechanistic relationship between P2RY8 signaling and cell proliferation

  • Consider the role of P2RY8 in regulating the transcriptional activity of oncogenes like c-Myc

The expression pattern of P2RY8-CRLF2 fusion protein has been correlated with B-cell acute lymphoblastic leukemia occurrence rates, suggesting potential applications in avian lymphoid malignancy research .

What is the role of P2RY8 in autoimmune conditions, and how can this be studied in chicken models?

P2RY8 has a newly discovered role in immune tolerance that may be relevant for systemic autoimmune diseases. Research has revealed P2RY8 variants in patients with systemic lupus erythematosus (SLE) or lupus-related antiphospholipid syndrome (APS) . To investigate this relationship in chicken models, researchers could:

  • Generate chicken models with altered P2RY8 expression or function

  • Examine B cell development and selection processes

  • Assess antibody production and autoantibody formation

  • Analyze plasma cell differentiation and accumulation

Research indicates that P2RY8 enforces B cell-negative selection, with expression reinforcing negative selection at the T1 to follicular B cell transition, leading to decreased frequencies of potentially autoreactive B cells . This suggests a crucial role in preventing autoimmunity that could be explored in comparative studies between avian and mammalian models.

What are the critical factors for successful recombinant expression of chicken P2RY8?

For optimal recombinant expression of chicken P2RY8, researchers should consider:

  • Expression vector selection: Vectors containing appropriate promoters for the chosen expression system are essential. For mammalian expression, vectors like those from Sino Biological (Cat #HG22967-ACGLN) have been successfully used for human P2RY8 .

  • Tagging strategy: GFP-tagged or Flag-tagged constructs facilitate detection and purification. These tags can be incorporated at either N- or C-terminus, though researchers should validate that the tag doesn't interfere with receptor function.

  • Host cell selection: For proper membrane localization and post-translational modifications, mammalian cell lines are generally preferred over bacterial expression systems.

  • Purification approach: For membrane proteins like P2RY8, detergent solubilization and affinity chromatography are typically required for purification from cell membranes.

How can researchers accurately assess P2RY8 activation in experimental settings?

To accurately measure P2RY8 activation, researchers can employ multiple complementary approaches:

  • Signaling pathway activation: Measure downstream effectors of P2RY8 signaling, including:

    • cAMP production (adenylyl cyclase pathway)

    • ERK phosphorylation (MAPK pathway)

    • Phospholipase C activation

    • CREB and Elk-1 phosphorylation

  • Transcriptional changes: Assess the transcriptional activity of:

    • Serum response element (SRE)

    • c-Fos and c-Myc expression levels

  • Functional readouts: Evaluate cellular processes regulated by P2RY8:

    • B cell migration inhibition

    • Plasma cell differentiation rates

    • B cell selection in tolerance models

For comparative studies, it's important to include both positive controls (adenosine and uridine nucleotides) and negative controls (receptor antagonists or inactive receptor mutants).

How does chicken P2RY8 compare structurally and functionally to mammalian homologs?

While specific comparative data between chicken and mammalian P2RY8 is limited in the provided research context, general principles can guide researchers:

  • Sequence homology: Researchers should analyze sequence alignment between chicken and mammalian P2RY8 to identify conserved domains, particularly the seven transmembrane regions and ligand-binding sites.

  • Functional conservation: Evidence suggests functional roles may be conserved across species. For instance, P2RY8's role in immune regulation appears similar between chicken and human contexts, with P2Y purinergic receptors showing differential expression during immune responses in chickens .

  • Signaling pathway comparison: The activation of adenylyl cyclase, ERK pathways, and phospholipase C by P2RY8 likely represents conserved signaling mechanisms across species, though species-specific differences in downstream effectors may exist.

When designing comparative studies, researchers should consider:

  • Using orthologous ligands to assess receptor activation

  • Examining species-specific differences in expression patterns

  • Comparing tissue distribution and developmental regulation

What are the tissue-specific expression patterns of P2RY8 in chickens versus mammals?

Tissue-specific expression patterns of P2RY8 show both similarities and differences between chickens and mammals:

  • Immune tissues: In chickens, differential expression of P2Y purinergic receptors has been observed in immune tissues during viral infections . Some purinergic receptors show tissue-specific expression patterns, with P1A1, P2X1, and P2X6 specifically expressed in whole lung lavage cells .

  • B cell compartments: In humans, P2RY8 is well expressed by immature B cells . This expression pattern may also exist in chickens, though direct comparative data is limited.

  • Response to disease: Both chicken and mammalian P2RY8 show altered expression patterns in response to disease states, suggesting conserved regulatory mechanisms .

For comprehensive tissue distribution studies, researchers should consider employing:

  • RT-qPCR analysis across multiple tissues

  • Immunohistochemistry with validated antibodies

  • Single-cell RNA sequencing to identify cell-specific expression patterns

What are the potential therapeutic applications of targeting P2RY8 in avian diseases?

Emerging research suggests several potential therapeutic applications for targeting P2RY8 in avian diseases:

  • Viral infections: Purinergic receptors have been reported as potential therapeutic targets for viral infections, including herpesviruses . P2Y purinergic receptors show differential expression during Marek's disease virus (MDV) infection and disease progression in chickens , suggesting P2RY8-targeted interventions might modulate antiviral responses.

  • Lymphoproliferative disorders: Given P2RY8's potential contribution to leukemogenesis , inhibiting P2RY8 signaling might represent a therapeutic strategy for avian lymphoid malignancies.

  • Immune modulation: P2RY8's role in restraining plasma cell formation suggests that modulating its activity could help regulate antibody responses in vaccination or autoimmune contexts.

For researchers exploring these applications, considerations include:

  • Developing specific agonists or antagonists for chicken P2RY8

  • Evaluating tissue-specific delivery systems

  • Assessing effects on both pathogen clearance and immune homeostasis

How might CRISPR/Cas9 technology be applied to study P2RY8 function in avian models?

CRISPR/Cas9 technology offers powerful approaches for investigating P2RY8 function in avian models:

  • Gene knockout studies: Complete deletion of P2RY8 would allow assessment of its necessity in immune development and function. Researchers could:

    • Design guide RNAs targeting conserved exons of chicken P2RY8

    • Generate knockout cell lines for in vitro studies

    • Create germline P2RY8 knockout chickens for in vivo analysis

  • Point mutation introduction: To study specific variants identified in disease states (such as L257F, N97K, or E323G variants found in lupus patients ), researchers could:

    • Use homology-directed repair to introduce precise mutations

    • Create cellular or animal models carrying these variants

    • Compare functional outcomes with wild-type controls

  • Promoter modification: Altering P2RY8 expression levels through promoter editing could reveal dose-dependent effects. This approach would enable:

    • Creation of models with varied expression levels

    • Assessment of threshold effects in signaling pathways

    • Evaluation of compensatory mechanisms

When implementing CRISPR/Cas9 approaches in avian models, researchers should consider:

  • Optimizing delivery methods for avian cells

  • Validating editing efficiency using appropriate sequencing techniques

  • Characterizing off-target effects

  • Establishing clear phenotypic readouts for functional assessment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.