Recombinant Chicken Peripherin-2 (PRPH2)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant Chicken PRPH2 is synthesized using heterologous expression systems, including E. coli, yeast, baculovirus, or mammalian cells . The protein is purified to ≥85% purity via SDS-PAGE .

Host SystemsPurityApplications
E. coli≥85%Structural studies, bioassays
Baculovirus≥85%Functional assays, protein complexes
Mammalian Cells≥85%Post-translational modification studies

3.1. Gene Therapy and Disease Modeling

PRPH2 overexpression in Rom1−/− mice rescues OS disc enclosure defects, demonstrating its redundancy with ROM1 in OS morphogenesis . Overexpression of PRPH2 (30% above wild-type levels) restores normal disc structure in Rom1−/− retinas .

3.2. Antibody Development

Chicken polyclonal antibodies against PRPH2 are used in:

  • Western Blot (WB): 1:20,000 dilution to detect PRPH2 in rat retina/eye tissue .

  • Immunofluorescence (IF/ICC): 1:2,000–5,000 dilution for localization studies .

Antibody CharacteristicsDetails
ImmunogenRecombinant rat PRPH2 (E. coli)
Cross-ReactivityHuman, Rat, Mouse, Pig, Cow
Molecular Weight~57 kDa (predicted), ~35–39 kDa (observed)

4.1. PRPH2-ROM1 Interactions

PRPH2 forms hetero-oligomers with ROM1, which are essential for OS stability. In Rom1−/− mice, PRPH2 overexpression compensates for ROM1 loss, restoring disc enclosure .

ConditionPRPH2:ROM1 RatioOutcome
Wild-Type (WT)2:1Normal OS structure
Rom1−/−N/ADisrupted discs (rescued by PRPH2 OE)

4.2. Disease Mechanisms

Pathogenic PRPH2 mutations (e.g., R172W) disrupt complex formation with ROM1, causing aggregation and OS degeneration . Overexpression of wild-type PRPH2 in rds+/− mice improves rod function but not cone defects, highlighting species-specific vulnerabilities .

Therapeutic Implications

PRPH2 is a target for gene therapy in retinal degenerations. AAV-mediated delivery of PRPH2 improves OS structure in rod-dominant models (e.g., rds+/− mice), though cone-specific challenges remain .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PRPH2; RDS; Peripherin-2; CRDS1; Photoreceptor outer segment membrane glycoprotein 1; Retinal degeneration slow protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
Full length protein
Species
Gallus gallus (Chicken)
Target Names
PRPH2
Target Protein Sequence
MALLKVKFNQKKRVKLAQGLWLMNWFSVFAGIIVFSMGLFLKIELRKRSEVMDNSESHFV PNSLILMGILSCAFNGFAGKICYDSLDPAKFAKWKPLLKPYLALCFFFNILLFFVALICF LMRGSLESTLAQGLKNSMKFYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFKDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQVTNNSAHYSYDYQT EELNLWGRGCREALLHYYSSMMSSMGAVVLLVWLFEMSVMVGLRLLHTSLESIANPEDPE CESEGWILENSLKDTLKSALESLKKIGKFNQVEAGAEGAEGEEAGKTPAITTVS
Uniprot No.

Target Background

Function
May be involved in the morphogenesis of retinal outer segment disks and the development and maintenance of retinal ultrastructure.
Gene References Into Functions
  1. Our study reveals contrasting roles of per(WT) and Rom-1 in rod outer segment (OS) targeting of adRP-linked peripherin-2 mutants, suggesting a novel therapeutic strategy for affected individuals. PMID: 28539581
Database Links

KEGG: gga:395899

STRING: 9031.ENSGALP00000016098

UniGene: Gga.532

Protein Families
PRPH2/ROM1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.